KEGG   Treponema caldarium: Spica_0331Help
Entry
Spica_0331        CDS       T01573                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
scd  Treponema caldarium
Pathway
scd00500  Starch and sucrose metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
Module
scd_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:scd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spica_0331
Enzymes [BR:scd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Spica_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AEJ18496
UniProt: F8EZY3
LinkDB All DBs
Position
complement(374628..377165)
Genome map
AA seq 845 aa AA seqDB search
MNISTYTVKPKLPVPLKPLEEIARNLWLSWNFDAVMLFIRLDYDLWLKSQQNPARMLGMV
SQERLEKMAEDDSYLAALKDVYDRFQHYKKRDTWYKGSRKDMIAYFSMEYGMDVSLPIYS
GGLGILSGDHMKTSSDLGLPLVGVGLLYRQGYFKQYLNGDGFQQESYPENDWYNMPVERK
LDKQGKPIKITVETGDRIVVAQIWEVKVGRSSLFLLDTNIEENAPDLRDITASLYGGDRE
TRIRQEIVLGIGGIRALRALGINPAVTHMNEGHSAFLGLERIRELMHDQHLSFEEARQAL
WPTNVFTTHTPVPAGNERFGIDLMEKYFRPWAQELGLPWKEFLALGRENPDDDREPFCMT
ILALKLAAYCNGVARLHGKVSREMWKNIWPGLPIHEVPIGHVTNGVHPRTWVSNNMVELL
DRYFGPHFEEEPTDLNIWNRMERISDEELWRTHERRRERLVAFARDRIRRQLQRNGATES
RIQQAEDALSPYTLTIAFARRFATYKRANLLLRDPERLLKLLRDSERPIQLIFAGKAHPH
DMPGKDLIREIIHFAEKYDVVSKIVFLEDYDMTMAKYMTSGADLWLNTPRRPLEASGTSG
MKAAMNGVLNCSILDGWWDEAYKPEIGWAIGQGEQYEDTNLQDEIESKALYDLLEREIIP
LFYTRGRDGLPREWIRRMKTCMKEIGQSMSCHRMLMDYSNKYYFPALKNYKRLVKDNYQE
SKALAAYLQKLRNAWHELSVLKVESNARPVMQRGDLVTVNACVRLGSLAPEELCVELYYG
SISNFGDIEHAQRAEMKPIAQEGDCYKFQVKITCESTGHQGHTVRILPKHEGLVHPYVPG
LIKWA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcaacctataccgtcaaaccaaaattaccggttcctctgaaaccgctggag
gaaatagcccgtaatctctggttatcctggaatttcgatgcggtgatgctgtttatccgc
ctggattatgacctgtggctcaaatcccagcagaatccagcccggatgctcggcatggta
agccaggaacggctcgaaaaaatggccgaagacgattcttatctggctgccctcaaggat
gtctacgaccgtttccagcattataagaaacgagatacctggtataagggcagccgcaag
gacatgatcgcctatttctccatggaatatggtatggatgtgtcccttcctatctattct
gggggtcttggtattctttcaggggaccacatgaaaacctcttcggacctggggcttcct
ttggttggtgtaggactcctgtatcgacagggttactttaaacagtaccttaatggtgat
ggtttccaacaggaatcctaccctgaaaacgattggtacaacatgccggtggagcgaaaa
ctagacaaacaaggtaaacctatcaaaataactgtagagacaggagaccgtattgtggtt
gcccagatttgggaagtcaaggtaggccgtagttctctgtttttactcgacaccaatatt
gaagaaaatgctcccgatttacgggatataaccgcaagtctctatggaggagaccgggaa
accagaattcggcaggaaattgtccttgggatcggcggaatacgagcattacgggcctta
ggcatcaatcccgcagtaacccacatgaatgaaggtcactcggcttttctgggactcgaa
cggatccgcgaattgatgcacgatcagcatctcagtttcgaagaagcccggcaagccctt
tggccaaccaatgtgtttactacccatacccccgtccctgctggaaacgaacggttcggt
atcgatcttatggagaaatatttccgaccatgggcacaggaattagggcttccctggaaa
gaatttttagctctgggcagagaaaaccccgacgatgaccgggaacccttctgcatgacc
atcctggctttaaaactcgctgcctattgcaatggggtagcccgattgcatgggaaggtt
tcccgggaaatgtggaaaaatatttggcccggacttcccatccatgaagttcccataggc
catgtgactaatggcgttcacccccgtacctgggtttccaataacatggtagagctcttg
gatcgctattttggcccccattttgaagaagagccaacagacctgaatatctggaatcgg
atggaacgtatttctgatgaagaactctggagaacccatgaacggcgccgggaacggctt
gtagcctttgcccgggataggattcgccggcaattacaacggaacggggccaccgaaagc
agaattcaacaggcagaggatgccctctcaccctacaccctcaccatagcctttgctcgc
cgctttgctacgtataaacgggctaacctgcttctacgggacccagagcggctcctgaaa
ctgcttcgggattcagaacgccccatccagcttatttttgccgggaaagcccatcctcat
gacatgcctggaaaagatttaatccgggagattattcattttgcagaaaaatacgatgtg
gtcagtaaaatcgtattcctggaagactatgacatgaccatggccaagtatatgaccagt
ggagcggacctctggctcaacacaccccggcggcctttagaagcaagcggcacgagcggc
atgaaggcagccatgaatggggttctcaactgctctattcttgatggctggtgggatgag
gcttataaaccggaaatcggctgggccataggccagggagaacaatacgaggatactaat
ctgcaggatgaaatagaaagcaaggccctctatgatcttctggaacgggagatcatcccc
ctcttctatacccgtggccgggatggcttgccccgggaatggatccgtcgaatgaaaacc
tgcatgaaggaaatagggcagtcaatgtcatgccataggatgctgatggattattccaat
aagtactatttccctgccctgaaaaattataagcggcttgtaaaagataattaccaggaa
tcgaaagccctggcagcatatttgcagaaacttcgaaatgcctggcatgagctgtcggtt
ctcaaggtggagtccaatgcacggcctgtgatgcagcggggagacctcgtgacggtgaat
gcctgtgtacggctcggaagccttgcaccggaagagctctgcgtggaactctactatggc
tccatctccaactttggcgatattgaacatgcccaacgggcagagatgaagcctatagct
caggagggggactgttataaatttcaggttaagattacctgcgaatcgacaggccaccag
ggacacaccgtaagaatactgccgaagcatgaagggctcgtacatccctatgtacctggc
ctcattaaatgggcttaa

DBGET integrated database retrieval system