KEGG   Treponema caldarium: Spica_1825Help
Entry
Spica_1825        CDS       T01573                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scd  Treponema caldarium
Pathway
scd00010  Glycolysis / Gluconeogenesis
scd00051  Fructose and mannose metabolism
scd00562  Inositol phosphate metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
scd01120  Microbial metabolism in diverse environments
scd01130  Biosynthesis of antibiotics
scd01200  Carbon metabolism
scd01230  Biosynthesis of amino acids
Module
scd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_1825
   00051 Fructose and mannose metabolism
    Spica_1825
   00562 Inositol phosphate metabolism
    Spica_1825
Enzymes [BR:scd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spica_1825
Exosome [BR:scd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spica_1825
  Exosomal proteins of bladder cancer cells
   Spica_1825
  Exosomal proteins of melanoma cells
   Spica_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: AEJ19963
UniProt: F8F3L9
LinkDB All DBs
Position
complement(2007574..2008323)
Genome map
AA seq 249 aa AA seqDB search
MRNYFIAGNWKMHKTRAEAAELAQALVAQLKDGKHKYLVAPSFTALETVGKIVAGTNIML
GAQNMAAEEQGAHTGEVSVLQLKDLGVQAVILGHSERRHLYKEDDALINKKVRLALKHGL
EVILCIGELLEEREAGKAEAVCETQTVKGLEGVTTEELKRVTIAYEPVWAIGTGKTATPE
DADAIHAFVRKVIGKLYGEAAAQSICIQYGGSVKPENAAQLMAKPNIDGALVGGAALKAE
TFVPIAKFA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaattattttattgcgggtaactggaaaatgcataaaacccgtgccgaagctgcc
gagcttgctcaagccctggttgcccaattgaaagatggaaaacacaaatacctggttgct
cctagctttaccgctctggagactgttggaaagattgttgccggtaccaatatcatgtta
ggtgcacagaatatggccgccgaagaacagggtgcccatactggagaagtatctgttctc
cagctgaaagatctgggtgttcaggctgttattcttggtcatagtgaacgccgtcacctc
tataaagaagatgatgcactgatcaacaaaaaggttcgtctcgctctgaaacatggcctt
gaagtaattctctgtatcggcgaacttctggaagagcgggaagccggtaaagctgaagcg
gtttgtgagactcagaccgtcaaagggctcgagggtgttactacggaagaacttaaacgg
gtaactattgcctatgagcctgtctgggctattggtaccggtaaaaccgctacaccggaa
gatgcagatgcaatccatgctttcgttcgtaaggttatcggaaagctctatggtgaagcc
gctgctcagtctatctgtatccagtatggtggttcggtaaaaccagaaaatgcagcccag
ctcatggcaaagccaaatatagatggggctctggttggaggtgccgcccttaaggctgaa
accttcgtacctattgcaaagtttgcataa

DBGET integrated database retrieval system