KEGG   Treponema caldarium: Spica_2850Help
Entry
Spica_2850        CDS       T01573                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
scd  Treponema caldarium
Pathway
scd00040  Pentose and glucuronate interconversions
scd00051  Fructose and mannose metabolism
scd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spica_2850
   00051 Fructose and mannose metabolism
    Spica_2850
Enzymes [BR:scd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Spica_2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Asp_decarbox ADH_zinc_N_2 Spermine_synth TrkA_N Methyltransf_25 UDPG_MGDP_dh_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AEJ20943
UniProt: F8F3A6
LinkDB All DBs
Position
3216179..3217210
Genome map
AA seq 343 aa AA seqDB search
MKALLLDNVKHFSYTDVPEPSITEPDHVLIQIKAASICGSDVHGIDGSTGRRIPPIIMGH
EASGIIKATGPAVHHFSPGDRVTFDSTIYCGNCFYCRRGEVNLCDDRRVIGVSCKEYKQD
GAFAEYLVVPERVLYALPDEVDFIHGALTEPVAVVAHALRLARLSPGDSVLIVGTGLIGL
LLLQLVRLHTSGQIIAVDIDEKRLKLAEKLGADAAILVGPDVSYQIQSLTHGRGVDQAFE
VVGSEKTVTTAIEGLRKGGHLTLVGNVSPSINLPLQAVVTRQLDLQGSCAISGEYEFALQ
LMASQKINVDSIISAVAPLKDGALWFERLYNREPGLLKVVLEL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttgctattagataatgttaagcacttcagttatacagatgtaccagaacca
tcgattactgagccagaccacgtgttgatacaaataaaagcagcatctatttgtggcagt
gatgttcatggaatagatggttcaacaggacggcgtattccacccatcatcatgggccac
gaagcatccgggattataaaagcaacagggccagcagttcatcattttagtcctggagat
cgggttaccttcgattccactatatattgcggcaattgtttttattgccgtcgtggagag
gtaaatctctgtgatgatcgccgggttatcggggtttcctgtaaggaatataaacaggat
ggagcattcgcagaatacctcgttgtaccagaacgagttctctatgcactacccgatgag
gtggattttattcatggagcacttactgaaccggtagcggttgtagcccatgcgttacgt
cttgccagacttagtcctggcgactcggttctcatcgtaggaaccggtcttattgggtta
ttgctccttcaacttgttcggcttcacacatccggtcagattattgctgtggatatcgat
gaaaaacggcttaaactcgcagaaaaattaggagccgatgcagctattcttgttggacct
gatgttagctaccagatacaatccttaacacatggtcgtggcgttgatcaggcttttgaa
gtggttggatcagaaaaaaccgttactactgccatagaagggcttcgaaaaggagggcat
ttaaccttagtaggcaatgtcagtccatcaatcaatctccccctccaggctgtggtaacc
cgtcaacttgatttgcaaggttcctgtgctatttcaggagaatatgagtttgccctccaa
ctcatggcttctcaaaaaattaatgtagattctattatcagtgctgtagcgcccctcaag
gatggagctctctggtttgaaaggctctataatcgggaaccagggttattaaaggttgta
ctggagctttga

DBGET integrated database retrieval system