KEGG   Saccharomyces cerevisiae (budding yeast): YAL016W
Entry
YAL016W           CDS       T00005                                 

Gene name
TPD3, FUN32
Definition
(RefSeq) protein phosphatase 2A structural subunit TPD3
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YAL016W (TPD3)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YAL016W (TPD3)
   04113 Meiosis - yeast
    YAL016W (TPD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YAL016W (TPD3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YAL016W (TPD3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YAL016W (TPD3)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     YAL016W (TPD3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     YAL016W (TPD3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     YAL016W (TPD3)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd Ecm29 Cnd1
Other DBs
NCBI-GeneID: 851217
NCBI-ProteinID: NP_009386
SGD: S000000014
UniProt: P31383
LinkDB
Position
I:124879..126786
AA seq 635 aa
MSGARSTTAGAVPSAATTSTTSTTSNSKDSDSNESLYPLALLMDELKHDDIANRVEAMKK
LDTIALALGPERTRNELIPFLTEVAQDDEDEVFAVLAEQLGKFVPYIGGPQYATILLPVL
EILASAEETLVREKAVDSLNNVAQELSQEQLFSDFVPLIEHLATADWFSSKVSACGLFKS
VIVRIKDDSLRKNILALYLQLAQDDTPMVKRAVGKNLPILIDLLTQNLGLSTDEDWDYIS
NIFQKIINDNQDSVKFLAVDCLISILKFFNAKGDESHTQDLLNSAVKLIGDEAWRVRYMA
ADRFSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVREAVAKQVSGFAKFLNDPSIILNK
ILPAVQNLSMDESETVRSALASKITNIVLLLNKDQVINNFLPILLNMLRDEFPDVRLNII
ASLKVVNDVIGIELLSDSLLPAITELAKDVNWRVRMAIIEYIPILAEQLGMQFFDQQLSD
LCLSWLWDTVYSIREAAVNNLKRLTEIFGSDWCRDEIISRLLKFDLQLLENFVSRFTILS
ALTTLVPVVSLDVVTEQLLPFISHLADDGVPNIRFNVAKSYAVIVKVLIKDEAKYDALIK
NTILPSLQTLCQDEDVDVKYFAKKSLAECQELLKN
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtctggagcaagatcaacaacggcaggtgccgtgccctcggcagcaacaacatcaaca
acatcaacaacgtcaaactctaaggactcagactctaacgagtcattatatcccttggct
ctgcttatggatgagttaaaacatgatgatattgctaatagggtagaagccatgaaaaaa
ctagataccatcgcgttggcactcggtcccgaaagaacaagaaacgagttgattcccttt
ttaacggaagttgcacaagatgatgaagatgaggtgtttgccgttttagccgaacagtta
ggaaaatttgtcccctacattggcggtcctcaatacgccacaatcctattaccagttttg
gaaattttggcatctgcagaagaaactttggttagagaaaaggccgtagattctctgaat
aacgtggcccaagaactttctcaagaacaattatttagtgacttcgtccctttaattgaa
catttagctactgcagattggttttcttcaaaagtttctgcttgtggtcttttcaagtct
gttattgttagaatcaaagatgattcattgagaaagaatatcctggctttatacttacaa
ctcgctcaagatgatactccaatggtgaaaagggccgtcggtaaaaacctgcccatcttg
atcgatctgttgactcaaaatttgggattatctacagacgaagattgggattacatttct
aacattttccagaaaatcattaacgataatcaagattctgtcaagtttctggcagttgat
tgtttaatttccatcttgaaattttttaacgctaaaggtgatgagtctcacactcaagat
ttattgaactctgctgtcaaattaattggtgacgaagcgtggagggtacgttacatggct
gccgatagattttcagatttagcctcgcaattcagttccaaccaagcatatatcgatgaa
ttagtacaaccatttttgaacctttgtgaggacaacgagggagatgttagggaagctgtg
gctaaacaagtttctgggtttgccaagttcctaaatgatccttcaattatattgaataag
atcttacctgctgtgcagaatttgagtatggacgaaagtgaaacagtgagatctgctttg
gcttctaagattacaaatattgtattactgttgaataaagatcaagtcattaacaatttt
cttccgattttactgaatatgctaagagatgagttccctgacgttcgtttaaatatcatt
gccagcttgaaggttgtcaatgacgtaataggaattgagctgctatcagactctttgtta
cctgccataacagaattagccaaggacgtgaattggagagttagaatggctataattgag
tacatacctatcttggcagaacaattaggtatgcaattttttgaccaacagttaagcgat
ttatgtctttcatggttgtgggatactgtttattctatcagagaagccgcagtgaataat
ttaaaaaggttaacggaaatatttggctctgattggtgtcgtgatgaaattatttcaaga
ctgctcaaatttgatctacaattactggaaaattttgtctcgaggttcacaatactctct
gctctaaccactttggtgcccgtggtatcgttagatgtcgttactgagcaactattacca
ttcatttctcacttggctgatgacggtgttccaaatattaggtttaatgtggccaaatcc
tacgctgtgatagtgaaggttttaattaaggacgaggccaaatatgatgcattaattaag
aacacaattttaccctcattgcaaacgctgtgtcaagacgaagatgttgatgtaaaatac
ttcgctaagaaaagtttggcagaatgtcaagaacttttaaaaaattga

KEGG   Saccharomyces cerevisiae (budding yeast): YDL134C
Entry
YDL134C           CDS       T00005                                 

Gene name
PPH21
Definition
(RefSeq) phosphoprotein phosphatase 2A catalytic subunit PPH21
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YDL134C (PPH21)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YDL134C (PPH21)
   04136 Autophagy - other
    YDL134C (PPH21)
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL134C (PPH21)
   04113 Meiosis - yeast
    YDL134C (PPH21)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YDL134C (PPH21)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL134C (PPH21)
   04131 Membrane trafficking [BR:sce04131]
    YDL134C (PPH21)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDL134C (PPH21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDL134C (PPH21)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YDL134C (PPH21)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     YDL134C (PPH21)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     YDL134C (PPH21)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   Others
    YDL134C (PPH21)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     YDL134C (PPH21)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL134C (PPH21)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 851421
NCBI-ProteinID: NP_010147
SGD: S000002292
UniProt: P23594
LinkDB
Position
IV:complement(219662..220771)
AA seq 369 aa
MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPL
ELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHG
QFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHES
RQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQV
RELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARA
HQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSV
SRKTPDYFL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatacagatttagatgtgcctatgcaagatgctgttaccgaacagctgactcccaca
gtatctgaagatatggatctcaacaacaattcatcggataataatgcagaagaattctcg
gttgatgatttaaaacctggttcctcgggcatagcagatcacaaatcttccaaaccacta
gaactgaataacacaaatataaatcagcttgaccaatggattgagcatttgagtaaatgc
gagccactatcagaagacgatgtagcacgactatgtaaaatggcggtggacgtgttgcag
ttcgaggagaatgttaaaccaattaacgtgcctgttaccatttgtggtgacgtacacggt
caattccatgacttgttagaactttttaagattggtggcccttgtcctgacaccaattac
cttttcatgggtgattacgtggatagaggatattattctgttgaaactgtatcttaccta
gttgccatgaaagtcagatacccacatagaattacgatactgagaggcaatcacgagtct
aggcagattacccaagtatacgggttttatgatgaatgtttgagaaagtacggcagtgca
aacgtgtggaaaatgttcacagatcttttcgattattttcctataaccgcattagtagat
aataaaattttctgtctgcatggaggactttcccccatgatagaaaccatagatcaggtg
agagagttgaacagaatacaggaagtgcctcatgaaggtcctatgtgtgaccttctatgg
tcagaccctgacgatagaggcggatggggaatcagtcccagaggtgcaggcttcactttt
ggacaagatgtcagtgagcaattcaatcacactaatgatctatcactaatagcaagagct
caccaattggtaatggaaggctatgcttggtctcaccagcaaaatgttgtcaccattttc
agtgctcctaattactgctacagatgtggtaatcaagcagctatcatggaagtggacgag
aatcataatagacaattcttacagtacgacccatccgtaagaccaggtgaacctagcgtc
agcagaaagacgccagattactttttatga

KEGG   Saccharomyces cerevisiae (budding yeast): YDL188C
Entry
YDL188C           CDS       T00005                                 

Gene name
PPH22, PPH2
Definition
(RefSeq) phosphoprotein phosphatase 2A catalytic subunit PPH22
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YDL188C (PPH22)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YDL188C (PPH22)
   04136 Autophagy - other
    YDL188C (PPH22)
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL188C (PPH22)
   04113 Meiosis - yeast
    YDL188C (PPH22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YDL188C (PPH22)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL188C (PPH22)
   04131 Membrane trafficking [BR:sce04131]
    YDL188C (PPH22)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDL188C (PPH22)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDL188C (PPH22)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YDL188C (PPH22)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     YDL188C (PPH22)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     YDL188C (PPH22)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   Others
    YDL188C (PPH22)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     YDL188C (PPH22)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL188C (PPH22)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 851339
NCBI-ProteinID: NP_010093
SGD: S000002347
UniProt: P23595
LinkDB
Position
IV:complement(123865..124998)
AA seq 377 aa
MDMEIDDPMHGSDEDQLSPTLDEDMNSDDGKNNTKARSNDEDTDEELEDFNFKPGSSGIA
DHKSSKPLKLTNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPV
TICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRIT
ILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSP
MIETIDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTN
DLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPS
VRPGEPTVTRKTPDYFL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggatatggaaattgatgaccctatgcatggttcagatgaagatcaattatcaccgact
ctcgacgaagacatgaatagtgatgacggcaaaaataatacgaaggcgcgttctaatgac
gaagacacagatgaagagttggaagattttaattttaaaccggggtcctcgggtatagca
gatcataaatcctccaaaccactaaaactgaccaatacaaatataaatcagcttgaccaa
tggattgagcatttgagtaaatgcgagccactatcagaagacgatgtagcacgactatgt
aaaatggcggtggacgtgttgcagttcgaggagaatgttaaaccaattaacgtgcctgtt
accatttgtggtgacgtacacggtcaattccatgacttgttagaacttttcaagattggt
ggtccttgtcctgacaccaattaccttttcatgggtgattacgtggatagaggatattat
tctgttgagaccgtatcttacctagttgccatgaaagtcagatatccacatagaattact
atacttaggggcaatcacgagtctaggcagattacccaagtatatgggttttatgacgaa
tgtttgagaaagtacggcagtgcgaacgtgtggaaaatgtttaccgatctattcgattat
ttccccgttactgccttggtggataataaaatcttctgtttgcatggaggtctctcaccc
atgatagagacaatagatcaagttagagatttaaatagaatacaggaagtgcctcacgaa
ggtccaatgtgtgaccttctatggtccgatcctgatgatagaggcggatggggaatcagt
ccgagaggtgcaggcttcacttttggtcaagacatcagtgagcaattcaatcacactaat
gacctatcactaatagcaagagctcaccaattggtaatggaaggatattcttggtctcac
cagcaaaatgttgtcaccattttcagtgctccaaattattgttatagatgtggtaaccag
gccgctattatggaggtggatgaaaaccataataggcaattcttacaatacgatccatct
gtgagacccggtgaaccaaccgtcaccaggaagacaccggattatttcttataa

DBGET integrated database retrieval system