KEGG   Saccharomyces cerevisiae (budding yeast): YAL061WHelp
Entry
YAL061W           CDS       T00005                                 

Gene name
BDH2
Definition
(RefSeq) putative dehydrogenase BDH2
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YAL061W (BDH2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     YAL061W (BDH2)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     YAL061W (BDH2)
    1.1.1.-  
     YAL061W (BDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 ADH_zinc_N_2 2-Hacid_dh_C Shikimate_DH F420_oxidored NAD_binding_7 Pyr_redox DAO ABC_transp_aux
Motif
Other DBs
NCBI-GeneID: 851238
NCBI-ProteinID: NP_009340
SGD: S000000057
UniProt: P39713
LinkDB All DBs
Position
I:33448..34701
Genome map
AA seq 417 aa AA seqDB search
MRALAYFGKGNIRFTNHLKEPHIVAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTH
EISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWC
AACKKGYYNICSYLGLCGAGVQSGGFAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH
AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP
TAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFRGTAVNLAMWGHHKIQ
FSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDIDRARHMITGRVNIEDGLDGAIM
KLINEKESTIKIILTPNNHGELNREADNEKKEISELSSRKDQERLRESINEAKLRHT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagagccttagcgtatttcggtaaaggtaacatcagattcaccaaccatttaaaggag
ccacatattgtggcgcccgatgagcttgtgattgatatcgaatggtgtggtatttgcggt
acggacctgcatgagtacacagatggtcctatctttttcccagaagatggacacacacat
gagattagtcataacccattgccacaggcgatgggccacgaaatggctggtaccgttttg
gaggtgggccctggtgtgaaaaacttgaaagtgggagacaaggtagttgtcgagcccaca
ggtacatgcagagaccggtatcgttggcccctgtcgccaaacgttgacaaggaatggtgc
gctgcttgcaaaaagggctactataacatttgttcatatttggggctttgtggtgcgggt
gtgcagagcggtggatttgcagaacgtgttgtgatgaacgaatctcactgctacaaagta
ccggacttcgtgcccttagacgttgcagctttgattcaaccgttggctgtgtgctggcat
gcaattagagtctgcgagttcaaagcaggctctacggctttgatcattggtgctggcccc
atcggactgggcacgatactggcgttgaacgctgcaggttgcaaggacatcgtcgtttca
gagcctgccaaggtaagaagagaactggctgaaaaaatgggtgccagggtttacgaccca
actgcgcacgctgccaaggagagcattgattatctgaggtcgattgctgatggtggagac
ggcttcgattacacatttgattgctccgggttggaagtcacattgaatgctgctattcag
tgtctcactttcagaggcaccgcagtgaacttggccatgtggggccatcacaagatacag
ttttctccgatggacatcacattgcatgaaagaaagtacacagggtccatgtgctacaca
caccacgattttgaggcagtaatagaagctttggaagaaggcaggattgacattgataga
gcaagacatatgataacgggcagagtcaacattgaggacggccttgatggcgccatcatg
aagctgataaacgagaaggagtctacaatcaagattattctgactccaaacaatcacgga
gagttgaacagggaagccgataatgagaagaaagaaatttccgagctgagcagtcggaaa
gatcaagaaagactacgagaatcaataaacgaggctaaactgcgtcacacatga

DBGET integrated database retrieval system