KEGG   Saccharomyces cerevisiae (budding yeast): YBL016WHelp
Entry
YBL016W           CDS       T00005                                 

Gene name
FUS3, DAC2
Definition
(RefSeq) mitogen-activated serine/threonine-protein kinase FUS3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBL016W (FUS3)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBL016W (FUS3)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    YBL016W (FUS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YBL016W (FUS3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YBL016W (FUS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YBL016W (FUS3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YBL016W (FUS3)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   YBL016W (FUS3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     YBL016W (FUS3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YBL016W (FUS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 852265
NCBI-ProteinID: NP_009537
SGD: S000000112
UniProt: P16892
LinkDB All DBs
Structure
PDB: 

Position
II:192451..193512
Genome map
AA seq 353 aa AA seqDB search
MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQ
TLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMT
EYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIG
TPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITA
KEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagagaattgtatacaatatatccagtgacttccagttgaagtcgttactggga
gagggtgcatacggtgtggtatgttctgcaacgcataagcccacgggagaaatcgtggca
ataaaaaagatcgaaccattcgataagcctttgttcgcattacgtacgctgcgtgaaata
aagatcctgaagcacttcaagcacgaaaatatcataacaatcttcaacattcaacgccct
gactcgttcgaaaacttcaatgaggtctacataattcaagagctaatgcagacagattta
caccgtgtaatctccacccagatgctgagtgacgatcatatacaatattttatataccaa
accttgagagcagtgaaagtgctgcatggttcgaacgtcatccatcgtgatttaaagccc
tccaaccttctcataaactccaactgtgacttgaaagtatgtgatttcggtttagcaaga
atcattgacgagtcagccgcggacaattcagagcccacaggtcagcaaagcggcatgacc
gagtatgtggccacacgttggtacagggcgccagaggtgatgttaacctctgccaaatac
tcaagggccatggacgtgtggtcctgcggatgtattctcgctgaacttttcttaagacgg
ccaatcttccctggcagagattatcgccatcaactactactgatattcggtatcatcggt
acacctcactcagataatgatttgcggtgtatagagtcacccagggctagagagtacata
aagtcgcttcccatgtaccctgccgcgccactggagaagatgttccctcgagtcaacccg
aaaggcatagatcttttacagcgtatgcttgtttttgaccctgcgaagaggattactgct
aaggaggcactggagcatccgtatttgcaaacataccacgatccaaacgacgaacctgaa
ggcgaacccatcccacccagcttcttcgagtttgatcactacaaggaggcactaacgacg
aaagacctcaagaaactcatttggaacgaaatatttagttag

DBGET integrated database retrieval system