KEGG   Saccharomyces cerevisiae (budding yeast): YBL023C
Entry
YBL023C           CDS       T00005                                 

Gene name
MCM2
Definition
(RefSeq) MCM DNA helicase complex subunit MCM2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBL023C (MCM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBL023C (MCM2)
   04113 Meiosis - yeast
    YBL023C (MCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBL023C (MCM2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBL023C (MCM2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBL023C (MCM2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBL023C (MCM2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    YBL023C (MCM2)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA AAA_30
Other DBs
NCBI-GeneID: 852258
NCBI-ProteinID: NP_009530
SGD: S000000119
UniProt: P29469
LinkDB
Structure
PDB: 

Position
II:complement(174920..177526)
AA seq 868 aa
MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPD
IDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERD
RLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREE
LTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSE
SLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDF
PTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIR
ISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKP
GEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEE
EREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVL
LLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLAD
KGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
LPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELK
NNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQ
MDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKV
VVDSFVDAQKVSVRRQLRRSFAIYTLGH
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgtctgataatagaagacgtagacgtgaggaagatgattcggactcagaaaatgagcta
ccgccatcctcacctcagcaacattttagaggggggatgaacccagtttcatcacctatt
ggttctccagatatgattaaccctgaaggtgacgataatgaagttgacgatgtaccagat
attgatgaagttgaagaacaaatgaacgaagtagatttgatggacgataatatgtatgag
gattatgcggctgatcataatagagatagatatgatccagatcaagttgacgacagggaa
caacaagaactatctttaagcgaacgtcgccgcattgatgctcaactaaatgaaagagat
aggctattgagaaatgttgcctacatagatgacgaggacgaagaacaagaaggtgcagcg
caacttgatgaaatgggccttcctgtgcaaagacgaagaaggagaaggcagtatgaggac
ttagagaatagtgatgacgatctattgagtgacatggacattgacccattaagagaagaa
cttactttagaatctctgagtaacgttaaggctaacagttactcggaatggataacacaa
cctaatgtctcaagaactattgccagagagttaaaatcattcctgctggaatatacagat
gaaacgggtcgttctgtatatggtgcacgtattagaacattaggtgaaatgaattctgaa
tctttggaggttaattatagacacttagcggagtccaaagccatcctggcactattttta
gctaaatgtccagaagaaatgttgaaaatattcgatctcgtggctatggaggcaacagaa
ttgcattacccagattatgcccgtattcactccgaaattcacgtaagaatctctgatttt
ccaacaatatacagtttacgtgaattgcgtgagtctaatttgtcctctctagtacgcgtc
actggggtggtgacaagaagaacaggagtcttccctcaattaaaatatgtcaaattcaat
tgtttgaaatgtggctccattttgggcccattttttcaagattctaatgaagaaattaga
atctcattctgtacaaactgcaaatcaaaaggtccctttagagtcaatggagaaaaaact
gtgtaccgaaattatcaaagggttacgctccaggaagctcccggaaccgttcctccaggc
cgtctaccaagacatagagaagtcattttgttggcggatttggtagatgtatccaagcca
ggtgaagaggtagaagttaccggcatctacaaaaataactacgatggtaacttgaatgca
aagaacggattccccgtttttgcaacaattatcgaggcaaattctataaaaagaagagag
ggcaatacagctaacgaaggcgaagaagggttggatgttttcagttggactgaagaagaa
gaacgtgaatttagaaagatttctagggatcgtggtataattgataaaattatatcatcg
atggcaccgtctatctatggtcatagagatattaaaactgcagtcgcgtgctcattattt
ggaggtgttccaaaaaacgtcaatggaaaacattctattcgtggtgatatcaatgtgtta
ttattaggtgatccaggtactgccaaatctcaaatcttaaaatacgtcgagaaaacagcg
catagagcggtctttgcaactggtcagggtgcttcggctgtcggtctgacagcatccgtc
agaaaagatcctattactaaagaatggaccttagaagggggggcgctagtattggctgat
aagggtgtttgtttaattgatgaattcgataagatgaacgatcaggatcgtacatctatt
catgaggctatggaacagcaaagtatttccatttccaaggccggtattgttactacatta
caagcgcgctgctcaattattgctgcggcaaatcctaatggtggtagatataattcaacc
ttgcctttagctcagaatgttagtttgaccgagcctattctgtctagatttgatatttta
tgtgttgtcagagaccttgttgatgaagaggcagacgaaagattggccacatttgttgtc
gattctcatgtaagatctcatccagaaaacgatgaagatcgagaaggcgaagagcttaaa
aataatggcgaatcggcgatagaacaaggagaagatgaaataaatgagcagcttaatgca
aggcaaagaagacttcaaagacaaaggaagaaggaggaagagatctcgcctattccacag
gaattattgatgaaatatattcactatgcgaggacaaaaatataccctaaattgcatcag
atggatatggataaggttagcagggtatatgcggatttgagaagagaaagtatttctaca
ggttcgtttccaatcacagttcgtcatttagaatctattctaagaattgcagaatctttt
gctaaaatgagattatctgaatttgtgtcttcttatgatttggatagagctatcaaagtt
gtagttgattcctttgttgatgcccaaaaagtcagtgttcgccgccaactccgcaggtct
ttcgcaatttataccttgggtcactaa

KEGG   Saccharomyces cerevisiae (budding yeast): YBR202W
Entry
YBR202W           CDS       T00005                                 

Gene name
MCM7, CDC47
Definition
(RefSeq) mini-chromosome maintenance complex protein 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBR202W (MCM7)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR202W (MCM7)
   04113 Meiosis - yeast
    YBR202W (MCM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YBR202W (MCM7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR202W (MCM7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBR202W (MCM7)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YBR202W (MCM7)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBR202W (MCM7)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_lid_2 Sigma54_activat AAA_3 IL3 Mg_chelatase_C DUF455 AAA
Other DBs
NCBI-GeneID: 852501
NCBI-ProteinID: NP_009761
SGD: S000000406
UniProt: P38132
LinkDB
Structure
PDB: 

Position
II:625772..628309
AA seq 845 aa
MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKG
PKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRA
IDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDA
LREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLIT
VRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFM
STRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPY
TGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAP
EIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRG
VYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEV
MEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLM
LDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYV
VQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLV
RVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLS
NCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDI
DLQDA
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgagtgcggcacttccatcaattcagcttcctgtcgactataataatctttttaatgaa
atcaccgattttttggtgactttcaagcaggatacgttgtcttctgatgcaacacgaaat
gagaacgaagatgaaaatttggatgctgagaatatcgaacaacatctattggaaaagggg
cccaagtacatggcgatgctacagaaagtggctaatagggaactgaattccgtgattatt
gatttagatgacattctacagtatcaaaacgaaaagtttctccagggcacacaggcagac
gaccttgtgtctgccattcaacaaaacgctaatcacttcactgaattattttgccgtgcc
attgacaacaacatgccgctaccaacaaaagaaattgactacaaggacgacgttcttgat
gttattttaaaccaaaggagactgaggaatgagagaatgctctcggacaggaccaatgag
atccgaagcgaaaacctcatggataccacgatggatccaccctcttccatgaatgatgcg
ttaagagaagttgtcgaggatgaaactgagttatttcctcctaatttaactagacgctat
ttcctttattttaagcctctatcgcaaaattgtgctcgtcgttacaggaagaaagcaatt
agttctaaaccattatctgttaggcagattaaaggtgacttcctaggccaattgattacc
gtcagaggtattatcaccagagtttctgatgtcaaaccagctgtggaagttatcgcatat
acctgcgatcaatgtgggtacgaagttttccaagaggtcaactctcgtacttttactccg
ttgtcagaatgtacttccgaagaatgttcccaaaatcaaacaaagggtcaattgtttatg
agtacacgagcttccaaatttagtgcctttcaggaatgtaaaattcaggagttatcacaa
caagtgccagtgggtcatattcctaggtcgctaaatatccacgttaacgggacgctggta
agatctttatcgcctggtgatatcgtcgatgtaactggtatattcttgccagcgccctac
accggtttcaaagctttgaaagctggcttactgacagaaacttatttagaggcacagttt
gtccgtcaacacaagaagaaatttgcgtctttcagtctgacttctgatgtagaagagaga
gttatggaattaatcacctctggtgatgtttataataggctggcaaaatctattgcaccg
gaaatctacggtaacttggacgtaaagaaagcgttgctgctattacttgtcggaggtgtt
gataaaagggtaggtgacggtatgaaaatcagaggtgatatcaatgtttgtctgatgggt
gatcccggtgttgccaaatctcaactgctgaaggccatttgcaaaatatcacctcgagga
gtgtataccactggtaagggttcctcaggcgttggtctgaccgctgccgtcatgaaagat
cctgtcacggatgaaatgattctagaaggtggtgccttagtactcgctgataacggtatt
tgttgtatcgatgaatttgataagatggatgaaagtgacagaacggcaatccatgaagtt
atggaacaacaaacaatttcgatatccaaggcgggtatcaatacaactttgaacgccaga
acctcaatcttagcggcagcaaatccgttgtatggtagatataatcctagattatcacct
ctggacaatataaatctaccagctgctttactatccagatttgatattctcttcttaatg
ttagatataccaagtagagatgacgacgaaaaattagccgagcacgttacatatgtgcat
atgcataataaacaaccggatttggacttcactccagtagaaccctctaaaatgagagag
tacattgcctatgctaagacaaagaggccagtgatgagtgaagctgtaaacgattatgtg
gtgcaagcttacatcagattaagacaagactccaagagagaaatggattccaaattttcc
tttggtcaagccactccgagaactttactaggtattataagattatctcaagcgctagca
aagttaaggttggctgatatggtggatatagatgatgtggaggaagccttgaggttggtc
cgagtctccaaggaatcattgtatcaagaaaccaacaaatctaaagaagatgaaagcccc
acaacgaaaatctttacgatcatcaagaaaatgttacaagaaactggtaaaaacacgcta
tcatatgaaaatattgtgaaaactgtaagactaagagggtttaccatgctacaattaagc
aactgtatccaagaatattcttacttaaacgtctggcatttaattaatgagggtaacact
ttgaaattcgtggatgacggtaccatggacacagaccaggaagactcactagtgagcacg
cctaaactcgcaccacaaacgaccgcttccgctaatgtgagcgcccaagattctgatatc
gatctacaagacgcttga

KEGG   Saccharomyces cerevisiae (budding yeast): YEL032W
Entry
YEL032W           CDS       T00005                                 

Gene name
MCM3
Definition
(RefSeq) MCM DNA helicase complex subunit MCM3
  KO
K02541  DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YEL032W (MCM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YEL032W (MCM3)
   04113 Meiosis - yeast
    YEL032W (MCM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YEL032W (MCM3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YEL032W (MCM3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YEL032W (MCM3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YEL032W (MCM3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    YEL032W (MCM3)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid Mg_chelatase MCM_N ORC6 AAA_3 Sigma54_activat Stm1_N AAA_5 Ndc1_Nup
Other DBs
NCBI-GeneID: 856680
NCBI-ProteinID: NP_010882
SGD: S000000758
UniProt: P24279
LinkDB
Structure
PDB: 

Position
V:86937..89852
AA seq 971 aa
MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQ
DDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAY
FIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLV
SVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNK
LTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKS
LGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIF
DILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLR
FVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTD
VDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLL
SRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINP
EEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYV
QYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKT
VNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSG
SPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQL
GLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTIST
GRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNN
LMVADDKVWRV
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggaaggctcaacgggatttgatggagacgctactacttttttcgctccagacgctgtg
tttggtgacagagtgcgcagatttcaagagtttttagatactttcacctcatacagagac
tctgtaaggtccatacaagtttacaacagcaataacgcggccaactacaacgatgatcaa
gatgacgcagacgaacgagatttgctaggtgatgacgacggtgatgatcttgaaaaggaa
aagaaagcagcatcgtccacctcattgaatatactccctcacaggattatcatctcgctt
gatgacttgagagaattcgacaggtcgttctggtcgggcattttagtcgaaccagcatac
ttcatcccgcctgccgaaaaggcgcttactgacctagcagattccatggacgatgttcca
catcccaatgcctctgcagtatcgtctcgccatccttggaagctttcgttcaaaggctca
tttggtgcacacgcattgtctcctcgtactctaacggcacaacatttaaacaaactggtc
tctgttgagggtatcgtaactaagacttcgttggtcaggccaaagcttatcagatctgtc
cactacgcggcaaagactggtagattccattacagagattatacagatgctactacaact
ctcaccacccgcatcccaacgcctgccatctatccaacggaggacactgaaggtaacaaa
ctaaccaccgaatatgggtatagtacgttcatagaccatcagcgtatcactgtgcaagaa
atgcccgaaatggcccccgctggccaacttcccaggtccattgacgtcattctcgatgac
gaccttgtggacaagaccaagccaggtgacagagttaacgttgtcggggtattcaagtcg
cttggtgctggtggcatgaaccagtccaactctaatacattgatcgggttcaaaactctg
atcctaggtaatacggtgtatcctctccacgccagatccacgggtgtcgctgcgagacaa
atgttgacagatttcgatataagaaatatcaataaactatccaaaaaaaaggacattttc
gatatcttgtctcaatctttagcgccttctatttatggacatgaccatataaagaaagcc
attttattgatgctcatgggaggtgtggagaaaaatttagaaaatggctcgcatttaaga
ggtgacatcaatatcctaatggtgggtgatccatccactgccaagtcccaattgctaagg
tttgtgttgaatacagcatcactggcaattgctactactggtagaggttcttccggtgtc
ggtttgaccgcagcggtcactactgatagggaaacaggtgaaagaagactagaggctggt
gccatggttcttgctgaccgcggggttgtatgtattgatgaatttgataagatgacagat
gtggatagagtcgccattcatgaagtaatggaacaacaaacggtgacgattgccaaagca
ggtattcacacaacattaaatgctcgttgtagtgttattgctgccgcaaatcccgttttt
gggcagtacgatgtcaatagagatccacaccaaaacattgccctaccggactcgctgttg
tctcgttttgatttactatttgttgtgacagacgatatcaatgaaatcagagatagatcc
attagtgagcatgtcttaagaacacacagatatttgcctccaggttatttagagggtgaa
cctgtgagagagcgtttgaatttatcattagccgttggggaggatgcagatataaatcct
gaagagcattccaactccggggctggtgtagaaaatgaaggagaagatgatgaagaccat
gtcttcgaaaagttcaaccccttattacaagcaggtgctaagttagcaaaaaacaaaggt
aactataacggtacagaaattccaaagctagtcaccatcccattcttaagaaagtacgtt
caatatgccaaggaaagggttattccacagttaacacaagaagccatcaatgttattgtg
aaaaattatactgatttaagaaacgatgataataccaaaaaatcgcccattactgcaaga
actttggagactttgatcagattagccacagctcacgccaaagtcaggttatccaaaaca
gtcaacaaggtggatgctaaagtggctgccaatctactaaggtttgcactattgggtgag
gatatcggcaatgatatcgatgaagaggaaagtgaatacgaagaagctttgtcgaagagg
tctccacagaaatcaccgaaaaaaagacaaagagtcagacaaccagcaagcaactctgga
tccccaatcaaatctactccaagaaggtcaacggcatcttccgttaatgccacgccatcg
tcagcacgcagaatattacgttttcaagatgacgaacagaacgctggtgaagacgataac
gatataatgtcaccgcttcctgcggatgaggaagctgaattacaaagaaggcttcaactg
gggttgagagtgtctccaagacgtagagaacatcttcacgcacctgaggaaggttcgtcg
ggacctcttaccgaggtcggtactccaagattacctaacgtatcttctgcaggtcaggat
gatgagcaacaacagtcagttatttcttttgacaatgtggagcctggtaccatttctact
ggtagattgtctttaatctcaggtattattgcgcgtctgatgcaaacagaaatatttgaa
gaagaatcctatcctgtggcctctttgttcgaaagaatcaacgaagaactaccggaggag
gaaaaattctccgctcaagaatatttagcaggtttgaagatcatgtcggacagaaataac
ttaatggttgctgacgataaagtttggagagtctga

KEGG   Saccharomyces cerevisiae (budding yeast): YGL201C
Entry
YGL201C           CDS       T00005                                 

Gene name
MCM6
Definition
(RefSeq) MCM DNA helicase complex subunit MCM6
  KO
K02542  DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YGL201C (MCM6)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGL201C (MCM6)
   04113 Meiosis - yeast
    YGL201C (MCM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YGL201C (MCM6)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YGL201C (MCM6)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YGL201C (MCM6)
SSDB
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase Sigma54_activat GIDA_assoc AAA_3 AAA_5
Other DBs
NCBI-GeneID: 852673
NCBI-ProteinID: NP_011314
SGD: S000003169
UniProt: P53091
LinkDB
Structure
PDB: 

Position
VII:complement(117854..120907)
AA seq 1017 aa
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgtcatccccttttccagctgacacaccaagcagtaatagaccttccaactcctctccg
ccaccatcgtcgataggtgctggcttcggaagcagtagcggactcgattcgcaaataggc
tctaggttacatttcccaagttcttctcaaccgcatgtcagtaattcacaaacaggccct
tttgttaacgattccactcagtttagttctcaaaggttgcaaaccgatggttccgcgact
aatgatatggagggaaatgaacctgccagaagcttcaaaagtagagctttgaatcacgtt
aagaaagttgatgacgttactggtgaaaaagtccgtgaagcgttcgagcagtttttggaa
gacttttccgttcaatccactgatactggtgaagttgaaaaagtttatagagctcaaatt
gaatttatgaaaatatatgacctaaacaccatttatatagattatcagcatttatccatg
agagaaaatggtgctctagctatggctatctcagaacaatattacagatttttgcctttt
ttacaaaagggtttaagaagagtagtaagaaagtatgcacctgaattgttaaacacaagt
gactcattgaagagatccgaaggtgacgaaggtcaagcggatgaagatgagcaacaggac
gatgatatgaatgggtcgagtctaccaagagattctggatcatcagccgcaccagggaat
gggacatctgccatggcaacgaggtcaataacaacttctacgtcacctgaacagacggaa
cgtgtttttcaaatcagtttcttcaatctaccaacagttcacagaattcgtgatataaga
tctgaaaagattggttcactattgagtatatcagggacagtgacaagaacatctgaggtc
cgtccagaattatacaaggcaagctttacgtgtgatatgtgccgtgctatcgtagataac
gtagaacagtccttcaagtacactgaaccgacattttgcccgaacccatcatgcgaaaat
agagccttttggacattaaatgttacaagatccaggtttcttgattggcaaaaagtcaga
attcaagaaaatgctaacgaaatacctacaggctccatgccgcgtacgctggacgtcatt
cttcgaggtgatagtgtcgaaagagccaagccaggtgaccgttgcaaatttacgggtgtg
gaaattgtagtacctgatgttacacaattggggctaccaggtgtgaagccaagttcaaca
ttagatactagaggtatttcgaagactactgaaggtttgaatagtggtgttactggttta
cgctctcttggtgttcgtgatttgacatacaagattagctttctggcatgccatgttatc
agtattggatcaaacattggtgcaagtagccctgatgcaaattctaacaaccgagaaact
gaactacagatggctgctaatttacaagctaataatgtataccaagataatgaaagagat
caagaagtattcttgaacagtttgagttcagatgaaataaatgagctgaaggaaatggta
aaggatgaacatatttatgataaattggtcagatctattgctccagctgtgtttggccat
gaagccgtaaagaagggtatcttgcttcagatgctcggtggtgttcataagagtactgta
gaaggtattaagttaagaggagatatcaacatctgtgttgttggtgatccctctacttct
aagtctcaatttttaaaatacgtagtgggatttgcaccaagatcagtttacacttccggt
aaggcctcgtcggctgctggtttaacagctgcggttgtgagagatgaggaaggaggtgat
tatacaattgaagcaggtgctttaatgcttgctgataacggtatttgttgtatcgatgaa
tttgataaaatggatatttcagatcaagttgccattcatgaagctatggaacaacagacc
atctctattgctaaagctggtattcacgctactttaaatgcaagaacatcaattctagcg
gctgccaacccggtaggtggaagatacaataggaaactatcactgaggggtaatttaaat
atgaccgcaccgatcatgtccagatttgatttattttttgttattcttgatgactgtaac
gaaaaaattgataccgaattggcatctcatatcgttgacttacacatgaaaagagacgaa
gccattgagccgccatttagtgcagaacaactacgtcgttatatcaaatatgcacgtact
tttaaaccaatattaacgaaagaagcccgttcctatttagtcgagaagtataaggaactg
agaaaggatgatgcccagggatttagtagatcgagttatagaatcacagttaggcaactt
gaaagtatgattagattatcagaagctattgcgagggctaattgtgtcgatgaaattact
ccatcattcattgcagaagcttacgatcttttaaggcaaagtattattcgtgttgatgtg
gatgatgtggaaatggatgaagaatttgataacatagagagtcaaagtcacgccgcttct
ggaaacaatgatgacaatgatgatgggactgggtcaggtgtaattacgagtgagccacca
gcagatatagaagaaggacaaagcgaagctacagctcgtccaggtacaagcgagaagaag
aaaacaacggtgacgtatgataaatatgtgtccatgatgaacatgatcgttagaaagatt
gctgaagtagatagggagggtgcagaagaactaacagctgtggatatagttgattggtat
ttattacagaaggaaaatgatttgggttcgttagcagaatattgggaagagagaagatta
gcgttcaaagtcataaaaaggttggtcaaagataggattttaatggagattcatggtacc
agacacaatttaagagatcttgagaatgaggaaaatgaaaataataaaactgtttatgtt
attcatccaaactgtgaggttttggatcaattggaaccacaggattccagctaa

KEGG   Saccharomyces cerevisiae (budding yeast): YLR274W
Entry
YLR274W           CDS       T00005                                 

Gene name
MCM5, BOB1, CDC46
Definition
(RefSeq) MCM DNA helicase complex subunit MCM5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YLR274W (MCM5)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR274W (MCM5)
   04113 Meiosis - yeast
    YLR274W (MCM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLR274W (MCM5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLR274W (MCM5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YLR274W (MCM5)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YLR274W (MCM5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YLR274W (MCM5)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 DUF1822 AAA
Other DBs
NCBI-GeneID: 850980
NCBI-ProteinID: NP_013376
SGD: S000004264
UniProt: P29496
LinkDB
Structure
PDB: 

Position
XII:691555..693882
AA seq 775 aa
MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYS
LTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENT
SMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLS
IMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDP
YIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSI
YNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQL
SRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGT
AKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCID
EFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNI
DFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMK
RYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRIT
ESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKR
RLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgtcatttgatagaccggaaatatacagtgctcctgttttacaaggagaatctcctaac
gacgatgataatactgaaatcataaagtcctttaagaatttcattttggagttcagactt
gactcgcaatttatttacagagatcagttaaggaacaacatccttgtgaagaattattct
ttaacggttaacatggagcatttgatcggatataacgaagacatatataagaaactatca
gacgaaccttcagatatcattccattattcgaaaccgcgatcacacaagtggctaaaagg
ataagtattctaagcagagctcaatctgctaataacaatgacaaagatccagaaaatact
agtatggatactgattctctcttattgaactctttaccaacatttcaattaattttaaac
tccaatgcaaatcagattccattgagagatttggattctgaacacgtctccaagattgtc
cgtttatcaggtattataatatccacgtcagttttatcttcccgtgccacgtacctttct
ataatgtgcagaaattgcagacacacaacatcaataacaatcaacaatttcaattctatc
acaggcaataccgtcagtttaccacgttcttgcttatctacgattgagagtgaatcttct
atggcaaacgagtcgaatattggtgatgaatcgaccaagaaaaattgtggacctgatcca
tatattattatccatgagtcttcaaagtttattgatcaacagtttttaaaattacaggaa
atcccagaactggttccagtaggtgagatgcctagaaacttaacaatgacttgtgaccga
tacctaacaaacaaagttattcctggtacgagagtcactatagtaggtatttattccatc
tataattctaaaaatggtgccggatccggaaggagcgggggtggaaatggaggaagtggt
gttgctattagaacaccttatatcaaaatattaggtattcagtccgatgtagaaacctcc
tctatttggaattcagtaactatgtttactgaggaggaagaagaggaatttctacagcta
agtagaaacccgaagctttatgaaattttgaccaactctattgccccctctatttttggt
aatgaagatataaaaaaagccattgtatgtttattgatgggtggttccaagaagatatta
cccgatggtatgaggttaagaggtgatatcaatgtactattattaggtgatccaggtacc
gccaaatctcaactattgaaatttgtggagaaagtgtcacctattgcggtatatacatct
ggtaagggatcttctgcagctgggttaactgccagtgtacaaagagatccgatgacaaga
gaattttatttggaaggtggtgctatggtgcttgccgatggtggtgttgtatgcatcgat
gaattcgataaaatgagagatgaagatagagtggccattcatgaagctatggagcagcaa
acaatctccatcgcaaaagctggtatcactacagtgctaaattctagaactagtgtttta
gcggctgctaatccgatatacggccggtatgatgatttgaagtctcctggtgacaacatt
gatttccaaactactattttatcccgttttgatatgatttttattgttaaggatgaccat
aatgaagaacgtgatatttcaatagctaaccacgttattaatattcatacaggaaatgct
aatgctatgcaaaaccaacaagaggaaaatggcagtgaaattagtattgaaaagatgaaa
cgttacattacgtattgtagattgaaatgtgcaccaagactttcaccgcaggccgctgaa
aaactgtcatcgaacttcgtcaccattaggaagcaattattaatcaacgaattagagtca
acggaaaggtcgtctattccaattaccattcgtcaattagaagctattattagaataaca
gaatcattagccaagttagaattaagtcctattgcacaggagagacatgttgacgaagct
attagattgtttcaagcttccacaatggacgcagcgtctcaggatccaattggcggctta
aatcaagcaagcggaacatctttgtcagaaatccgtcgttttgaacaagaactaaaaaga
agattacctataggctggtctacttcttatcaaactttgaggagagaatttgtagataca
catagattttctcaattagcactggataaggccttatatgccctagagaagcatgaaaca
attcaattgagacaccagggacagaatatttacagaagtggtgtatga

KEGG   Saccharomyces cerevisiae (budding yeast): YPR019W
Entry
YPR019W           CDS       T00005                                 

Gene name
MCM4, CDC54, HCD21
Definition
(RefSeq) MCM DNA helicase complex subunit MCM4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YPR019W (MCM4)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YPR019W (MCM4)
   04113 Meiosis - yeast
    YPR019W (MCM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPR019W (MCM4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YPR019W (MCM4)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YPR019W (MCM4)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 DUF5805
Other DBs
NCBI-GeneID: 856130
NCBI-ProteinID: NP_015344
SGD: S000006223
UniProt: P30665
LinkDB
Structure
PDB: 

Position
XVI:596750..599551
AA seq 933 aa
MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEG
NIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSS
SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRII
WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN
LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF
YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI
DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY
DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTST
IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI
LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG
LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG
IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL
AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM
GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP
KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES
SDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgtctcaacagtctagctctccaacaaaagaggataataactccagctcccccgttgtg
cctaatcctgattctgttccaccacagctttcttccccagctctattttatagctcctct
tcatcacaaggtgatatctatggtcgcaacaatagccagaacttaagtcagggagaggga
aacatcagagctgctataggttcttctccactaaattttccatcttcttcccaaagacaa
aattccgatgttttccaatctcaaggcagacagggcagaattcgttcttctgcgagcgct
tctggaaggtctagatatcattctgatctgagaagtgatagagcactgcctacttcttcc
tcttctttaggccgtaatggtcaaaaccgtgtacacatgcgaagaaatgatattcataca
tctgatttatcctctccaagaagaattgtggattttgatactagatccggcgtgaatact
ttggatacttcttcttcttctgctcctccatcggaagccagtgaacccttgagaataatt
tggggtaccaacgtcagtatccaggaatgtacaactaattttcgtaattttttgatgtct
ttcaagtataaattccgtaaaatattggatgaaagggaggaattcattaacaatactacc
gacgaagaactatactatatcaagcagcttaatgaaatgagagaacttggtacctctaat
ttaaacttggatgctagaaacttacttgcttacaagcaaacagaagacttataccatcaa
ctattaaattatcctcaagaagtgatttctatcatggatcaaactatcaaggactgtatg
gtttccttaatagtagacaacaatttggattacgatttagatgaaatagagaccaagttt
tataaagtaaggccttacaatgtaggttcttgtaaaggtatgcgcgaattgaatccaaat
gatattgataaattgataaacttaaagggtcttgtcctgagatcaactccggttatccct
gatatgaaggtagcgtttttcaaatgcaacgtctgcgatcatacaatggcagtggaaatt
gatagaggagttatacaagagcccgctaggtgtgaacgtattgattgtaatgaacccaat
tccatgtcactgattcacaacaggtgttcattcgcagataaacaagtcattaagttacag
gaaactccagactttgtgcctgatggacaaacgcctcactctatctcattatgtgtttac
gatgaattagtggattcttgcagggcgggcgatcgtattgaggtgactggcacgttcagg
tccatccccattagagctaattccaggcaacgcgtactaaagtcgttgtataaaacatac
gtcgatgtggtccacgttaaaaaagtttcagataagaggttagacgtcgatacttctact
attgaacaagaattaatgcagaacaaggtagatcataacgaggtcgaagaagtaagacaa
attactgatcaggatttagcaaaaattcgcgaggttgcggcaagagaagatttatacagt
ttattagcccgctctattgccccaagtatttacgagctagaagatgtcaagaagggtata
ttacttcagctatttggcggcacgaataaaacctttaccaagggtggccgttatagaggt
gacataaatattttactttgtggggatccttctacttccaaatcgcaaattttgcaatac
gttcacaaaattactcctcgtggtgtgtatacttcgggtaaaggttcatctgccgttggt
ttaactgcttatattacaagggatgtcgacacaaaacaacttgttttggaaagtggtgca
ttagtattgtctgatggaggtgtttgttgtattgacgagtttgataaaatgagtgattct
acaaggtccgtcttgcacgaagtcatggaacagcagactatttcaatcgcaaaagcggga
attatcacaacacttaatgccagaagttctattttggccagtgctaacccaattggttca
cgctacaaccccaatttgcctgtgactgaaaatattgatctaccgcccccactactttcg
agattcgatctggtctatcttgtccttgataaggttgatgagaaaaatgacagagaacta
gccaaacacttaacaaatctttacctggaagataagcccgaacatatttctcaagacgac
gtgctaccagttgaatttttaacgatgtatattagttatgcaaaggagcacatacaccca
ataatcaccgaggccgctaagactgagcttgttcgtgcttatgtaggaatgagaaagatg
ggtgacgattcgagatccgatgagaagagaatcacagctaccacaagacaacttgaaagt
atgattcgtttggctgaggcgcacgccaaaatgaaattgaaaaacgtcgtagagctggag
gatgttcaagaagccgttagattaattagatcagccataaaagattatgcaacagaccct
aaaaccggtaaaatcgacatgaatttagttcaaacaggtaaatcagttattcagagaaaa
ctacaggaggatttgtcaagggaaattatgaatgttttgaaggatcaggcatcagactca
atgtcattcaatgagcttataaaacaaatcaatgaacactctcaagatagagttgagtct
tctgatatccaggaagccttgtcaagattgcaacaagaggacaaggtcattgtccttggc
gagggtgtaaggagatcagttcgcctgaataaccgtgtctga

DBGET integrated database retrieval system