KEGG   Saccharomyces cerevisiae (budding yeast): YBR060C
Entry
YBR060C           CDS       T00005                                 

Gene name
ORC2, RRR1, SIR5
Definition
(RefSeq) origin recognition complex subunit 2
  KO
K02604  origin recognition complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR060C (ORC2)
   04113 Meiosis - yeast
    YBR060C (ORC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR060C (ORC2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR060C (ORC2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBR060C (ORC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YBR060C (ORC2)
SSDB
Motif
Pfam: ORC2 AT_hook
Other DBs
NCBI-GeneID: 852352
NCBI-ProteinID: NP_009616
SGD: S000000264
UniProt: P32833
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
II:complement(360652..362514)
AA seq 620 aa
MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT
SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES
KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL
TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM
FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC
LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL
ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS
ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII
WVPYTYAELEKLLKTVLNTL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctaaatggggaagactttgtagagcataatgatatcctatcgtctccggcaaaaagc
aggaatgtaaccccaaaaagggttgacccacatggagaaagacaactgagaagaattcat
tcatcaaagaagaatttgttggaaagaatctcgcttgtaggcaacgaaaggaaaaataca
tctccagatccggcactcaaacctaaaacgccaagtaaagctccccgtaaacgtggaaga
ccaagaaagatacaggaagaattaactgataggatcaagaaggatgagaaagatacaatt
tcctctaagaaaaagaggaaattggacaaagatacatcaggtaatgtcaatgaggaaagc
aagacttctaacaacaagcaggtgatggaaaagacggggataaaagagaaaagagaacgc
gaaaaaatacaggtagcgaccacaacatatgaagataatgtgactccacaaactgatgat
aattttgtatcaaattcacccgagccaccagaacctgcaacaccatctaagaagtcttta
accactaatcatgattttacttcgcccctaaagcaaattataatgaataatttaaaagaa
tataaagactcaacctccccaggtaaattaaccttgagtagaaattttactccaacccct
gtaccgaaaaataaaaagctctaccaaacttcggaaaccaagtcagcaagctcgtttttg
gatacttttgaaggatatttcgaccaaagaaaaattgtcagaactaatgcgaagtcaagg
cacaccatgtcaatggcacctgacgttaccagagaagagttttccctagtatcaaacttt
ttcaacgaaaattttcaaaaacgtcccaggcaaaagttatttgaaattcagaaaaaaatg
tttccccagtattggtttgaattgactcaaggattctccttattattttatggtgtaggt
tcgaaacgtaattttttggaagagtttgccattgactacttgtctccgaaaatcgcgtac
tcgcaactggcttatgagaatgaattacaacaaaacaaacctgtaaattccatcccatgc
cttattttaaatggttacaaccctagctgtaactatcgtgacgtcttcaaagagattacc
gatcttttggtccccgctgagttgacaagaagcgaaactaagtactggggcaatcatgtg
attttgcagatccaaaagatgattgatttctacaaaaatcaacctttagatatcaaatta
atacttgtagtgcataatctggatggtcctagcataaggaaaaacacttttcagacgatg
ctaagcttcctctccgtcatcagacaaatcgccatagtcgcctctacagaccacatttac
gctccgctcctctgggacaacatgaaggcccaaaactacaactttgtctttcatgatatt
tcgaattttgaaccgtcgacagtcgagtctacgttccaagatgtgatgaagatgggtaaa
agcgataccagcagtggtgctgaaggtgcgaaatacgtcttacaatcacttactgtgaac
tccaagaagatgtataagttgcttattgaaacacaaatgcagaatatggggaatctatcc
gctaacacaggtcctaagcgtggtactcaaagaactggagtagaacttaaacttttcaac
catctctgtgccgctgattttattgcttctaatgagatagctctaaggtcgatgcttaga
gaattcatagaacataaaatggccaacataactaagaacaattctggaatggaaattatt
tgggtaccctacacgtatgcggaacttgaaaaacttctgaaaaccgttttaaatactcta
taa

DBGET integrated database retrieval system