KEGG   Saccharomyces cerevisiae (budding yeast): YBR202W
Entry
YBR202W           CDS       T00005                                 

Gene name
MCM7, CDC47
Definition
(RefSeq) mini-chromosome maintenance complex protein 7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YBR202W (MCM7)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR202W (MCM7)
   04113 Meiosis - yeast
    YBR202W (MCM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YBR202W (MCM7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR202W (MCM7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YBR202W (MCM7)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YBR202W (MCM7)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBR202W (MCM7)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_lid_2 Sigma54_activat AAA_3 IL3 Mg_chelatase_C DUF455 AAA
Other DBs
NCBI-GeneID: 852501
NCBI-ProteinID: NP_009761
SGD: S000000406
UniProt: P38132
LinkDB
Structure
PDB: 

Position
II:625772..628309
AA seq 845 aa
MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKG
PKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRA
IDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDA
LREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLIT
VRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFM
STRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPY
TGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAP
EIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRG
VYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEV
MEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLM
LDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYV
VQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLV
RVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLS
NCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDI
DLQDA
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgagtgcggcacttccatcaattcagcttcctgtcgactataataatctttttaatgaa
atcaccgattttttggtgactttcaagcaggatacgttgtcttctgatgcaacacgaaat
gagaacgaagatgaaaatttggatgctgagaatatcgaacaacatctattggaaaagggg
cccaagtacatggcgatgctacagaaagtggctaatagggaactgaattccgtgattatt
gatttagatgacattctacagtatcaaaacgaaaagtttctccagggcacacaggcagac
gaccttgtgtctgccattcaacaaaacgctaatcacttcactgaattattttgccgtgcc
attgacaacaacatgccgctaccaacaaaagaaattgactacaaggacgacgttcttgat
gttattttaaaccaaaggagactgaggaatgagagaatgctctcggacaggaccaatgag
atccgaagcgaaaacctcatggataccacgatggatccaccctcttccatgaatgatgcg
ttaagagaagttgtcgaggatgaaactgagttatttcctcctaatttaactagacgctat
ttcctttattttaagcctctatcgcaaaattgtgctcgtcgttacaggaagaaagcaatt
agttctaaaccattatctgttaggcagattaaaggtgacttcctaggccaattgattacc
gtcagaggtattatcaccagagtttctgatgtcaaaccagctgtggaagttatcgcatat
acctgcgatcaatgtgggtacgaagttttccaagaggtcaactctcgtacttttactccg
ttgtcagaatgtacttccgaagaatgttcccaaaatcaaacaaagggtcaattgtttatg
agtacacgagcttccaaatttagtgcctttcaggaatgtaaaattcaggagttatcacaa
caagtgccagtgggtcatattcctaggtcgctaaatatccacgttaacgggacgctggta
agatctttatcgcctggtgatatcgtcgatgtaactggtatattcttgccagcgccctac
accggtttcaaagctttgaaagctggcttactgacagaaacttatttagaggcacagttt
gtccgtcaacacaagaagaaatttgcgtctttcagtctgacttctgatgtagaagagaga
gttatggaattaatcacctctggtgatgtttataataggctggcaaaatctattgcaccg
gaaatctacggtaacttggacgtaaagaaagcgttgctgctattacttgtcggaggtgtt
gataaaagggtaggtgacggtatgaaaatcagaggtgatatcaatgtttgtctgatgggt
gatcccggtgttgccaaatctcaactgctgaaggccatttgcaaaatatcacctcgagga
gtgtataccactggtaagggttcctcaggcgttggtctgaccgctgccgtcatgaaagat
cctgtcacggatgaaatgattctagaaggtggtgccttagtactcgctgataacggtatt
tgttgtatcgatgaatttgataagatggatgaaagtgacagaacggcaatccatgaagtt
atggaacaacaaacaatttcgatatccaaggcgggtatcaatacaactttgaacgccaga
acctcaatcttagcggcagcaaatccgttgtatggtagatataatcctagattatcacct
ctggacaatataaatctaccagctgctttactatccagatttgatattctcttcttaatg
ttagatataccaagtagagatgacgacgaaaaattagccgagcacgttacatatgtgcat
atgcataataaacaaccggatttggacttcactccagtagaaccctctaaaatgagagag
tacattgcctatgctaagacaaagaggccagtgatgagtgaagctgtaaacgattatgtg
gtgcaagcttacatcagattaagacaagactccaagagagaaatggattccaaattttcc
tttggtcaagccactccgagaactttactaggtattataagattatctcaagcgctagca
aagttaaggttggctgatatggtggatatagatgatgtggaggaagccttgaggttggtc
cgagtctccaaggaatcattgtatcaagaaaccaacaaatctaaagaagatgaaagcccc
acaacgaaaatctttacgatcatcaagaaaatgttacaagaaactggtaaaaacacgcta
tcatatgaaaatattgtgaaaactgtaagactaagagggtttaccatgctacaattaagc
aactgtatccaagaatattcttacttaaacgtctggcatttaattaatgagggtaacact
ttgaaattcgtggatgacggtaccatggacacagaccaggaagactcactagtgagcacg
cctaaactcgcaccacaaacgaccgcttccgctaatgtgagcgcccaagattctgatatc
gatctacaagacgcttga

DBGET integrated database retrieval system