KEGG   Saccharomyces cerevisiae (budding yeast): YBR205WHelp
Entry
YBR205W           CDS       T00005                                 

Gene name
KTR3
Definition
(RefSeq) mannosyltransferase KTR3
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    YBR205W (KTR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YBR205W (KTR3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YBR205W (KTR3)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YBR205W (KTR3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 852504
NCBI-ProteinID: NP_009764
SGD: S000000409
UniProt: P38130
LinkDB All DBs
Position
II:633622..634836
Genome map
AA seq 404 aa AA seqDB search
MSVHHKKKLMPKSALLIRKYQKGIRSSFIGLIIVLSFLFFMSGSRSPEVPIAQGTSVSRV
ASKDYLMPFTDKSQGVIHPVDDGKKEKGVMVTLARNSDLWNLVKSIRHVEDRFNNRYHYD
WVFLNDQPFSDEFKRVTSALVSGKAKYGTIPKDHWSIPSWIDTEKFDEKRLAMGKLDIPY
GSSVPYRHMCRFQSGFIWRHPLLEEYEWFWRVDTDITLFCDIQYDIFKFLKVNNKKYGFI
LSVSEYERTIPTLWETTKKFIKKNPKFLHKNNLMKFISNDDGDTYNMCHFWTNFEIGSLD
FFRSDAYREYFDYLDSSGGFFYERWGDAPVHSIAASLFLDKSEIHFFDGLGFHHPDFTSC
PIEQKIRLQNKCICEPSKDVTWTPDYFCTRKYFSAGNYKLPPGI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcaccacaaaaagaagctaatgcccaaatcggcattgctgattagaaaatac
caaaagggaatcagatcatcattcattgggctcatcatagtgttatcctttttatttttc
atgagtggctcaaggtccccagaggtaccaatagctcagggcaccagtgtcagtcgtgta
gccagtaaggattatttgatgccgtttactgacaagtcacaaggagtaatccatcccgtg
gacgatggaaagaaggaaaagggtgttatggtcacattggccaggaattcagatttatgg
aacttggtaaaatctattagacatgttgaagacaggttcaataacagatatcactacgat
tgggtgttcttgaatgaccaaccatttagtgatgagtttaaacgtgttaccagtgcattg
gtttcaggcaaggcaaaatatgggacaatcccaaaggaccattggtccattccatcttgg
atcgatactgaaaaattcgatgagaaaaggcttgcaatgggaaaattggatattccatat
ggtagttccgtgccttaccgtcacatgtgccgtttccagtcagggttcatatggagacac
ccactactggaggagtacgaatggttttggagagtggataccgatatcactttattctgt
gatattcagtatgacatattcaagtttttaaaagtaaataacaagaaatatggattcatt
ctttcggtaagtgaatatgagcgcacaatcccaaccttgtgggaaacgacaaagaaattc
atcaagaaaaatcctaaattcttacacaaaaataacctcatgaaattcatttcgaatgat
gatggtgacacttataatatgtgtcatttctggaccaacttcgaaatcggctctttagac
ttcttcaggtccgatgcatacagagaatactttgattacttagacagttctggtggattc
ttctacgaaagatggggggatgcgccagtgcactccatcgctgcctctttgttcttggac
aagtcagaaatccatttctttgacggtcttggattccatcatccagatttcacctcttgt
cctatcgaacagaagattagactacaaaacaagtgtatctgcgaacctagcaaggacgtc
acctggactcctgactacttctgtactagaaagtacttttcagcaggaaattacaagctt
ccaccaggaatttaa

DBGET integrated database retrieval system