KEGG   Saccharomyces cerevisiae (budding yeast): YCL067C
Entry
YCL067C           CDS       T00005                                 

Gene name
HMLALPHA2, ALPHA2
Definition
(RefSeq) homeodomain mating type protein alpha2
  KO
K09359  mating-type protein A2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YCL067C (HMLALPHA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YCL067C (HMLALPHA2)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    YCL067C (HMLALPHA2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN GCIP Homez
Other DBs
NCBI-GeneID: 850292
NCBI-ProteinID: NP_009866
SGD: S000000572
UniProt: P0CY09 P0CY08
LinkDB
Structure
PDB: 
1MNM 1LE8 1AKH 1YRN 1APL

Position
III:complement(12386..13018)
AA seq 210 aa
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaataaaatacccattaaagaccttttaaatccacaaatcacagatgagtttaaatcc
agcatactagacataaataaaaagctcttttctatttgctgtaatttacctaagttacca
gagagtgtaacaacagaagaagaagttgaattaagggatatattaggattcttatctagg
gccaacaaaaaccgtaagattagtgatgaggagaagaagttgttgcaaacaacatctcaa
ctcactactaccattactgtattactcaaagaaatgcgcagcatagaaaacgatagaagt
aattatcaacttacacagaaaaataaatcggcggatgggttggtatttaatgtggtaact
caagatatgataaacaaaagtactaaaccttacagaggacaccggtttacaaaagaaaat
gtccgaatactagaaagttggtttgcaaagaacatcgagaacccatatctagataccaag
ggcctagagaatctaatgaagaataccagtttatctcgcattcaaatcaaaaactgggtt
tcgaatagaagaagaaaagaaaaaacaataacaatcgctccagaattagcggacctcttg
agcggtgagcctctggcaaagaagaaagaatga

KEGG   Saccharomyces cerevisiae (budding yeast): YCR039C
Entry
YCR039C           CDS       T00005                                 

Gene name
MATALPHA2, ALPHA2
Definition
(RefSeq) homeodomain mating type protein alpha2
  KO
K09359  mating-type protein A2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YCR039C (MATALPHA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YCR039C (MATALPHA2)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    YCR039C (MATALPHA2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN GCIP Homez
Other DBs
NCBI-GeneID: 850406
NCBI-ProteinID: NP_009868
SGD: S000000635
UniProt: P0CY09 P0CY08
LinkDB
Structure
PDB: 
1MNM 1LE8 1AKH 1YRN 1APL

Position
III:complement(199546..200178)
AA seq 210 aa
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaataaaatacccattaaagaccttttaaatccacaaatcacagatgagtttaaatcc
agcatactagacataaataaaaagctcttttctatttgctgtaatttacctaagttacca
gagagtgtaacaacagaagaagaagttgaattaagggatatattaggattcttatctagg
gccaacaaaaaccgtaagattagtgatgaggagaagaagttgttgcaaacaacatctcaa
ctcactactaccattactgtattactcaaagaaatgcgcagcatagaaaacgatagaagt
aattatcaacttacacagaaaaataaatcggcggatgggttggtatttaatgtggtaact
caagatatgataaacaaaagtactaaaccttacagaggacaccggtttacaaaagaaaat
gtccgaatactagaaagttggtttgcaaagaacatcgagaacccatatctagataccaag
ggcctagagaatctaatgaagaataccagtttatctcgcattcaaatcaaaaactgggtt
tcgaatagaagaagaaaagaaaaaacaataacaatcgctccagaattagcggacctcttg
agcggtgagcctctggcaaagaagaaagaatga

KEGG   Saccharomyces cerevisiae (budding yeast): YCR096C
Entry
YCR096C           CDS       T00005                                 

Gene name
HMRA2, A2
Definition
(RefSeq) homeodomain mating type protein A2
  KO
K09359  mating-type protein A2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YCR096C (HMRA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YCR096C (HMRA2)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    YCR096C (HMRA2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 850458
NCBI-ProteinID: NP_010020
SGD: S000000692
UniProt: P0CY13
LinkDB
Structure
PDB: 
1MNM 1LE8 1AKH 1YRN 1APL

Position
III:complement(293179..293538)
AA seq 119 aa
MRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKN
IENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE
NT seq 360 nt   +upstreamnt  +downstreamnt
atgcgcagcatagaaaacgatagaagtaattatcaacttacacagaaaaataaatcggcg
gatgggttggtatttaatgtggtaactcaagatatgataaacaaaagtactaaaccttac
agaggacaccggtttacaaaagaaaatgtccgaatactagaaagttggtttgcaaagaac
atcgagaacccatatctagataccaagggcctagagaatctaatgaagaataccagttta
tctcgcattcaaatcaaaaactgggtttcgaatagaagaagaaaagaaaaaacaataaca
atcgctccagaattagcggacctcttgagcggtgagcctctggcaaagaagaaagaatga

DBGET integrated database retrieval system