KEGG   Saccharomyces cerevisiae (budding yeast): YCR097W
Entry
YCR097W           CDS       T00005                                 

Gene name
HMRA1, YCR097WB
Definition
(RefSeq) Hmra1p
  KO
K09358  mating-type protein A1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YCR097W (HMRA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YCR097W (HMRA1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    YCR097W (HMRA1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez Helicase_PWI
Other DBs
NCBI-GeneID: 850459
NCBI-ProteinID: NP_010021
SGD: S000000694
UniProt: P0CY11
LinkDB
Structure
PDB: 
1AKH 1YRN 1F43

Position
III:join(293835..293939,293994..294239,294292..294321)
AA seq 126 aa
MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLE
IYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFIN
KRMRSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atggatgatatttgtagtatggcggaaaacataaacagaactctgtttaacattctaggt
actgagattgatgaaatcaatctcaatactaataatctttataattttataatggaaagt
aatttgactaaagtagagcaacatacattacacaaaaatatttctaacaataggttagaa
atataccaccacattaaaaaagagaagagcccaaagggaaaatcatcaatatcaccccaa
gcacgggcatttttagaacaggtttttagaagaaagcaaagccttaattccaaggaaaaa
gaagaagttgcaaagaaatgtggcattactccacttcaagtaagagtttggttcataaat
aaacgtatgagatctaaataa

DBGET integrated database retrieval system