KEGG   Saccharomyces cerevisiae (budding yeast): YDL066WHelp
Entry
YDL066W           CDS       T00005                                 

Gene name
IDP1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) IDP1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
sce04146  Peroxisome
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YDL066W (IDP1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YDL066W (IDP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YDL066W (IDP1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YDL066W (IDP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-GeneID: 851493
NCBI-ProteinID: NP_010217
SGD: S000002224
UniProt: P21954
LinkDB All DBs
Structure
PDB: 

Position
IV:334835..336121
Genome map
AA seq 428 aa AA seqDB search
MSMLSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDL
SVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNLHKMWKSPNGTIRNILG
GTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSDPTTA
QPQTLKVYDYKGSGVAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRF
KDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQ
GFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQKGEETSTNSIASIFAWSRGLLKR
GELDNTPALCKFANILESATLNTVQQDGIMTKDLALACGNNERSAYVTTEEFLDAVEKRL
QKEIKSIE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgttatctagaagattattttccacctctcgccttgctgctttcagtaagatt
aaggtcaaacaacccgttgtcgagttggacggtgatgaaatgacccgtatcatttgggat
aagatcaagaagaaattgattctaccctacttggacgtagatttgaagtactacgactta
tctgtcgaatctcgtgacgccacctccgacaagattactcaggatgctgctgaggcgatc
aagaagtatggtgttggtatcaaatgtgccaccatcactcctgatgaagctcgtgtgaag
gaattcaacctgcacaagatgtggaaatctcctaatggtaccatcagaaacattctcggc
ggtacagtgttcagagagcccattgtgattcctagaattcctagactggtcccacgttgg
gaaaaaccaatcattattggaagacacgcccacggtgatcaatataaagctacggacaca
ctgatcccaggcccaggatctttggaactggtctacaagccatccgaccctacgactgct
caaccacaaactttgaaagtgtatgactacaagggcagtggtgtggccatggccatgtac
aatactgacgaatccatcgaagggtttgctcattcgtctttcaagctggccattgacaaa
aagctaaatcttttcttgtcaaccaagaacactattttgaagaaatatgacggtcggttc
aaagacattttccaagaagtttatgaagctcaatataaatccaaattcgaacaactaggg
atccactatgaacaccgtttaattgatgatatggtcgctcaaatgataaaatctaaaggt
ggctttatcatggcgctaaagaactatgacggtgatgtccaatctgacatcgtcgctcaa
ggatttggctccttaggtttgatgacttctatcttagttacaccagacggtaaaactttc
gaaagtgaagctgctcatggtaccgtgacaagacattatagaaagtaccaaaagggtgaa
gaaacttctacaaactccattgcatccattttcgcgtggtcgagaggtctattgaagaga
ggtgaattggacaatactcctgctttgtgtaaatttgccaatattttggaatccgccact
ttgaacacagttcagcaagacggtatcatgacgaaggacttggctttggcttgcggtaac
aacgaaagatctgcttatgttaccacagaagaatttttggatgccgttgaaaaaagacta
caaaaagaaatcaagtcgatcgagtaa

DBGET integrated database retrieval system