KEGG   Saccharomyces cerevisiae (budding yeast): YDL125C
Entry
YDL125C           CDS       T00005                                 

Symbol
HNT1
Name
(RefSeq) adenosine 5'-monophosphoramidase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: HIT DcpS_C CwfJ_C_1
Other DBs
NCBI-GeneID: 851432
NCBI-ProteinID: NP_010158
SGD: S000002283
UniProt: Q04344
LinkDB
Position
IV:complement(join(239019..239398,239510..239606))
AA seq 158 aa
MEPLISAPYLTTTKMSAPATLDAACIFCKIIKSEIPSFKLIETKYSYAFLDIQPTAEGHA
LIIPKYHGAKLHDIPDEFLTDAMPIAKRLAKAMKLDTYNVLQNNGKIAHQEVDHVHFHLI
PKRDEKSGLIVGWPAQETDFDKLGKLHKELLAKLEGSD
NT seq 477 nt   +upstreamnt  +downstreamnt
atggagccattgatatcggcaccgtacctaacaacaacaaaaatgtctgctcctgctacg
cttgatgctgcctgtattttttgcaagattattaaaagcgaaattccatccttcaaattg
attgaaacaaagtactcgtatgctttcttggacatccaacctactgctgaaggtcatgct
ttaatcattcctaagtaccatggtgcgaagttgcatgacatcccggacgaattccttacc
gatgctatgccgattgccaagagactggccaaggcaatgaagttggacacttataatgtg
ttgcagaataatggtaaaattgcgcatcaagaagtcgaccacgtccacttccatttgatt
cctaagagagatgagaaaagtggtttgattgtagggtggccagcccaagaaacggacttc
gataagttgggcaagctacacaaggaattgcttgccaaactagaaggctccgattag

DBGET integrated database retrieval system