KEGG   Saccharomyces cerevisiae (budding yeast): YDL138W
Entry
YDL138W           CDS       T00005                                 

Gene name
RGT2
Definition
(RefSeq) glucose sensor
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDL138W (RGT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDL138W (RGT2)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDL138W (RGT2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 851417
NCBI-ProteinID: NP_010143
SGD: S000002297
UniProt: Q12300
LinkDB
Position
IV:213351..215642
AA seq 763 aa
MNDSQNCLRQREENSHLNPGNDFGHHQGAECTINHNNMPHRNAYTESTNDTEAKSIVMCD
DPNAYQISYTNNEPAGDGAIETTSILLSQPLPLRSNVMSVLVGIFVAVGGFLFGYDTGLI
NSITDMPYVKTYIAPNHSYFTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFST
AVIFSIGNSLQVASGGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQW
AITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELN
KAAKSLSFLRGLPIEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQILRIFT
GIAIQAFQQASGINFIFYYGVNFFNNTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRR
PVLLAGGVIMAIANLVIAIVGVSEGKTVVASKIMIAFICLFIAAFSATWGGVVWVVSAEL
YPLGVRSKCTAICAAANWLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVV
YFAVYETRGLTLEEIDELFRKAPNSVISSKWNKKIRKRCLAFPISQQIEMKTNIKNAGKL
DNNNSPIVQDDSHNIIDVDGFLENQIQSNDHMIAADKGSGSLVNIIDTAPLTSTEFKPVE
HPPVNYVDLGNGLGLNTYNRGPPSIISDSTDEFYEENDSSYYNNNTERNGANSVNTYMAQ
LINSSSTTSNDTSFSPSHNSNARTSSNWTSDLASKHSQYTSPQ
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgaacgatagccaaaactgcctacgacagagggaagaaaatagtcatctgaatcctgga
aatgacttcggccaccaccagggtgcagaatgtacgataaatcataacaacatgccacac
cgcaatgcatacacagaatctacgaatgacacggaagcaaagtccatagtgatgtgcgac
gatcctaacgcataccaaatttcctacacaaataatgagccggcgggagatggagctata
gaaaccacgtccattctactatcgcaaccgctgccgctgcgatcgaatgtgatgtctgtc
ttggtaggcatatttgttgccgtggggggcttcttgtttgggtatgacactggacttata
aacagtatcacggatatgccgtatgttaaaacctacattgctccgaaccattcatatttc
accactagccaaatagccatactcgtatcattcctctccctaggaacatttttcggtgcg
ttaatcgctccctatatttcagattcatatggtaggaagccaacaattatgtttagtacc
gctgttatcttttccatcggaaactcattacaggtggcatccggtggcttggtgctatta
atcgtcggaagagtgatctcaggtatcgggatcgggataatctctgctgtggttcctctt
tatcaagctgaagctgcgcagaagaaccttagaggtgccatcatttccagttatcagtgg
gctatcactattgggttactcgtgtccagtgcagtatcgcaaggaactcattccaaaaat
ggcccgtcttcatatagaataccaattggtttgcagtacgtttggtcaagtattttagct
gtgggcatgatattccttccagagagtccaagatattacgtcttgaaggatgaactcaat
aaagctgcaaaatcgttatcctttttaagaggcctcccgatcgaagatccaagactctta
gaggagcttgttgaaataaaagccacttacgattatgaagcatcgttcggcccgtcaaca
cttttagattgtttcaaaacaagtgaaaatagacccaaacagattttacgaatatttact
ggtatcgccatacaagcttttcaacaggcatctggtatcaattttatattctactatgga
gttaattttttcaacaacacaggggtggacaactcttacttggtttcttttatcagctat
gccgtcaacgtcgccttcagtataccgggtatgtatttagtggatcgaattggtagaaga
ccagtccttcttgctggaggtgtcataatggcaatagcaaatttagtcattgccatcgtt
ggtgtttccgagggaaaaactgttgttgctagtaaaattatgattgcttttatatgcctt
ttcattgctgcattttcggcgacatggggtggtgtcgtgtgggtggtatctgctgaactg
tacccacttggtgtcagatcgaaatgtaccgccatatgcgctgccgcaaattggctagtt
aatttcacctgtgccctgattacaccttacattgttgatgtcggatcacacacttcttca
atggggcccaaaatattcttcatttggggcggcttaaatgtcgtggccgttatcgttgtt
tatttcgctgtttatgaaacgaggggattgactttggaagagattgacgagttatttaga
aaggccccaaatagcgtcatttctagcaaatggaacaaaaaaataaggaaaaggtgctta
gcctttcccatttcacaacaaatagagatgaaaactaatatcaagaacgctggaaagttg
gacaacaacaacagtccaattgtacaggatgacagccacaacataatcgatgtggatgga
ttcttggagaaccaaatacagtccaatgatcatatgattgcggcggataaaggaagtggc
tcgttagtaaacatcatcgatactgcccccctaacatctacagagtttaaacccgtggaa
catccgccagtaaattacgtcgacttggggaatggtttgggtctgaatacatacaataga
ggtcctccttctatcatttctgactctactgatgagttctatgaggaaaatgactcttct
tattacaataacaacactgaacgaaatggagctaacagcgtcaatacatatatggctcaa
ctaatcaatagctcatctactacaagcaacgacacatcgttctctccatcacacaatagc
aatgcaagaacgtcctctaattggacgagtgacctcgctagtaagcacagccaatacact
tccccccaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YDL194W
Entry
YDL194W           CDS       T00005                                 

Gene name
SNF3
Definition
(RefSeq) glucose sensor
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDL194W (SNF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDL194W (SNF3)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDL194W (SNF3)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 851333
NCBI-ProteinID: NP_010087
SGD: S000002353
UniProt: P10870
LinkDB
Position
IV:111580..114234
AA seq 884 aa
MDPNSNSSSETLRQEKQGFLDKALQRVKGIALRRNNSNKDHTTDDTTGSIRTPTSLQRQN
SDRQSNMTSVFTDDISTIDDNSILFSEPPQKQSMMMSICVGVFVAVGGFLFGYDTGLINS
ITSMNYVKSHVAPNHDSFTAQQMSILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIF
IFSIGNSLQVGAGGITLLIVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAI
TWGLLVSSAVSQGTHARNDASSYRIPIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEA
AKSLSFLRGVPVHDSGLLEELVEIKATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGI
ALQAFQQFSGINFIFYYGVNFFNKTGVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKV
LVVGGVIMTIANFIVAIVGCSLKTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPL
GVRSKCTAICAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLT
VYETKGLTLEEIDELYIKSSTGVVSPKFNKDIRERALKFQYDPLQRLEDGKNTFVAKRNN
FDDETPRNDFRNTISGEIDHSPNQKEVHSIPERVDIPTSTEILESPNKSSGMTVPVSPSL
QDVPIPQTTEPAEIRTKYVDLGNGLGLNTYNRGPPSLSSDSSEDYTEDEIGGPSSQGDQS
NRSTMNDINDYMARLIHSTSTASNTTDKFSGNQSTLRYHTASSHSDTTEEDSNLMDLGNG
LALNAYNRGPPSILMNSSDEEANGGETSDNLNTAQDLAGMKERMAQFAQSYIDKRGGLEP
ETQSNILSTSLSVMADTNEHNNEILHSSEENATNQPVNENNDLK
NT seq 2655 nt   +upstreamnt  +downstreamnt
atggatcctaatagtaacagttctagcgaaacattacgccaagagaaacagggtttccta
gacaaagctcttcagagggtgaagggcatagcactgcgacgaaacaatagtaacaaagat
catacaacagatgatacgacaggtagcatacgaacccctacgagcttgcagcggcaaaat
tctgacaggcaatctaatatgacatccgtgtttacggatgacatttctaccatagacgac
aactcaattttattttcagagcctcctcagaaacaatctatgatgatgtctatatgcgta
ggtgtttttgttgcagttggcggatttttatttggttatgatacaggtctgatcaacagt
attacatctatgaactatgtgaagtcacacgtagcacctaatcacgattcatttaccgcc
caacaaatgtccattttggtgtcatttttgtcattgggaactttttttggggctttaact
gcaccatttatatctgattcgtatggcaggaagcctactatcattttcagtacaattttc
atcttctctatcggaaattctttacaggtaggtgctggaggaatcacattattgattgtg
ggaagggtcatttcaggtatcggtataggcgcaatttcagcggttgttccattataccaa
gcagaagctacacataaatcattaagaggtgctattatttctacttaccaatgggccatt
acctggggcttgctcgtgtcaagtgcagtgtcgcaagggacacacgcaagaaacgacgca
tcttcgtatcggattcccatagggttgcaatatgtctggtcgtcatttctcgctatcggg
atgttctttctccctgagagtccacgctattacgttttgaaagacaagctagatgaagca
gctaaatctttatcgtttttaagaggtgtaccagtccatgattctgggttactggaagaa
ctagttgaaataaaggcaacatatgattacgaggcatcttttggttcttcgaacttcatt
gattgttttatttcaagtaaaagtagaccaaagcaaactctaaggatgtttacgggaatt
gcccttcaagcatttcaacaattttcaggtatcaactttatattttactacggtgtcaat
ttcttcaataagacaggagtcagtaatagttatctggtttcatttataacctatgctgtt
aatgttgtctttaatgttcctggtttgttttttgtggaattttttggtagacgtaaggtg
ctggttgttgggggtgttatcatgactatagccaactttattgtggccattgttgggtgt
tccttaaagactgtagcggccgcaaaagttatgatagcatttatatgtctattcatagct
gccttttctgctacatggggtggtgttgtttgggttatttcagcagaactgtacccattg
ggtgtgagatctaaatgtacggctatatgcgctgctgctaactggcttgtaaactttatt
tgtgctttaattaccccttatattgtagatactgggtcgcatacatcatcattaggtgca
aaaatattcttcatttggggctccttaaatgcgatgggggtgatagttgtttacttgacc
gtttatgaaacgaagggtttgacattagaagagattgatgaattatatattaagtcatcc
actggtgtcgtgtcaccaaaatttaataaagatattagggaacgcgcacttaaattccaa
tacgatcctttgcaaagattagaagacggaaagaacacttttgttgctaaaagaaataat
tttgacgatgaaacaccaagaaatgattttcgaaatacgatatcgggcgaaatagatcat
agtcccaatcaaaaagaagttcattctatcccagaacgtgttgatattcctactagtaca
gaaattcttgaaagcccgaacaaaagtagtggtatgacagtccctgtgtcaccttctctg
caagacgttccaatcccgcaaacaacagagcctgctgaaattcgaaccaaatatgtggac
ctaggaaatgggcttggtcttaatacgtataatagagggcctccctcactctcaagcgac
tcaagcgaagattacacagaagatgaaataggcgggccctcatctcaaggcgaccaaagt
aatagaagtactatgaatgatattaatgattatatggcacgtctcattcacagtacttct
actgcaagtaacacgacagataagttctccggtaaccaaagtacccttcgttaccacacg
gcttcctcacattcggatacaactgaagaggacagcaatttgatggacctgggaaacggg
cttgccttgaatgcttataacagaggtccaccttcaattttaatgaattccagtgatgaa
gaggcaaatggtggtgagacgtctgataatttgaacacagctcaagacttggctggtatg
aaggaacgaatggcgcagtttgcgcagagctatattgacaagagaggcggtctggaacct
gaaactcaatctaatattttgagcacttctctctccgtgatggctgacactaatgaacat
aataatgaaatcctccactcaagcgaagaaaacgccactaatcaacctgtaaatgaaaat
aatgatttgaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YDL245C
Entry
YDL245C           CDS       T00005                                 

Gene name
HXT15, HLT2
Definition
(RefSeq) hexose transporter HXT15
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDL245C (HXT15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDL245C (HXT15)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDL245C (HXT15)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Pox_A14
Other DBs
NCBI-GeneID: 851352
NCBI-ProteinID: NP_010036
SGD: S000002404
UniProt: P54854
LinkDB
Position
IV:complement(11657..13360)
AA seq 567 aa
MASEQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLII
YLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV
GCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC
SVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFL
WALIIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINAGVLAQR
ELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI
VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKG
AGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTP
FITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPS
RRGASSRETEAKKKSWKEVLKFPKSFN
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcaagcgaacagtcctcaccagaaattaatgcagataatctaaacagtagtgcagct
gacgttcatgtacagccacccggagagaaagaatggtcagacgggttttatgacaaagaa
gtcattaatggaaatacgccagacgcaccgaagagaggctttttaggttaccttattatc
tacttactatgctatcctgtatcctttggcggttttttacctggttgggatagtggtatt
actgcaggcttcatcaatatggataactttaaaatgaattttggttcttacaagcacagt
actggtgagtattatttgagcaacgtgcgtatgggtcttctcgtggccatgttcagtgta
ggatgttccattggcggtgttgcttttgcgagacttgctgatactttaggtagaaggcta
gcaattgtaatcgtggttttggtatatatggttggtgcaattattcagatcagttcgaat
cacaaatggtaccaatactttgtcggtaagatcatctacggtcttggtgctggtggctgt
tcggtgttgtgtccaatgcttttatctgaaatagcccccacagatttgagaggtggactt
gtctcattgtaccaacttaacatgaccttcggtattttcttgggttattgtagcgtttat
ggaacaaggaagtatagtaatactgcgcaatggaggattcctgtgggactatgctttctg
tgggctctaattatcatcgttggcatgttattagttccagagtccccaagatatctgatt
gaatgtgagagacatgaagaggcctgtgtctccatcgccaagatcaacaaggtttcacca
gaggatccatgggtactcaaacaggctgatgaaatcaacgccggtgtccttgcccaaaga
gaactaggggaagcctcatggaaagaacttttctccgtcaaaacaaaagtccttcaacgt
ttgatcacaggtattcttgtgcaaacctttttgcaacttactggtgaaaactacttcttc
ttctacggaactaccattttcaaatcagttgggcttactgatgggtttgagacttcgatc
gtcctaggtacagtgaatttcttctccactattattgctgttatggtcgtagacaaaata
ggccgtcgtaaatgtctgttattcggagcggcttcaatgatggcttgtatggtcatattt
gcaagtatcggggtaaaatgtctttaccctcatggccaggatggtccatcctcgaaaggt
gcaggtaatgccatgattgtgttcacatgcttctatatattctgctttgcaacgacatgg
gcccctgttgcttatattgtggttgccgagtcattcccttcgaaggtcaaatctaaagca
atgtcaatttcgactgcattcaactggttatggcaattcttgattggttttttcacacca
ttcattactgggtctatccacttctattatggttatgtgttcgtaggttgtttggttgct
atgtttttgtacgttttcttctttttaccagaaacaattggtctatctttggaggaaatc
cagttactatatgaagaaggtataaaaccatggaaatctgcatcttgggtaccaccctca
aggagaggagcttcttccagggaaactgaggctaagaagaaaagctggaaagaagttttg
aagttcccaaagagttttaattga

KEGG   Saccharomyces cerevisiae (budding yeast): YDR342C
Entry
YDR342C           CDS       T00005                                 

Gene name
HXT7
Definition
(RefSeq) hexose transporter HXT7
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR342C (HXT7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR342C (HXT7)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDR342C (HXT7)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 851943
NCBI-ProteinID: NP_010629
SGD: S000002750
UniProt: P39004
LinkDB
Position
IV:complement(1154216..1155928)
AA seq 570 aa
MSQDAAIAEQTPVEHLSAVDSASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPAS
AYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVS
IFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLG
VGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGV
EAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSF
ETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIG
FFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASW
VPPSRRGANYDAEEMTHDDKPLYKRMFSTK
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgtcacaagacgctgctattgcagagcaaactcctgtggagcatctctctgctgttgac
tcagcctcccactcggttttatctacaccatcaaacaaggctgaaagagatgaaataaaa
gcttatggtgaaggtgaagagcacgaacctgtcgttgaaattccaaagagaccagcttct
gcctatgtcactgtctctattatgtgtatcatgatcgcctttggtggtttcgttttcggt
tgggatactggtaccatttctggtttcatcaatcaaaccgatttcatcagaagatttggt
atgaagcataaagatggtactaattatttgtctaaggttagaactggtttgattgtctcc
attttcaacattggttgtgccattggtggtattattctttccaaattgggtgatatgtac
ggtcgtaaggtgggtttgattgtcgttgttgtcatctacatcatcggtattattattcaa
attgcatctatcaacaaatggtaccaatatttcatcggtagaattatttccggtttgggt
gttggtggtattgccgttttatctcctatgttgatttctgaagtatccccaaagcattta
aggggtactttagtctcttgctaccaattgatgattactgccggtattttcttgggttac
tgtaccaacttcggtactaagaactactccaactctgtgcaatggagagttccattaggt
ttgtgttttgcctgggctttgtttatgattggtggtatgacatttgttccagagtctcca
cgttatttggctgaagtcggtaagatcgaagaagccaaacgttctattgccgtttctaac
aaggttgctgttgatgatccatctgttttggctgaagtcgaagctgtcttggctggtgta
gaggcagagaaattagctggtaatgcatcctggggtgaattgtttagtagcaagacaaag
gtccttcagcgtttgatcatgggtgctatgattcaatctctacaacaattgacaggtgat
aactatttcttctactatggtactactattttcaaggctgttggtttgagtgactctttc
gaaacctctattgtcttgggtattgttaactttgcttccacctttgttggtatttacgtt
gttgagagatatggtcgtcgtacttgtttgctatggggtgctgcatccatgactgcttgt
atggttgtctatgcttccgtgggtgtcaccagattatggccaaatggtcaagaccaacca
tcttccaagggtgctggtaactgtatgattgtctttgcctgtttctatattttctgtttt
gctactacatgggctccaattccttatgtcgttgtttctgaaactttcccattgagagtc
aagtctaaggctatgtctattgctacagctgctaattggttgtggggtttcttgattggt
ttcttcactccatttattactggtgctattaacttctactacggttacgttttcatgggc
tgtttggtcttcatgttcttctatgttttgttagttgttccagaaactaagggtttgact
ttggaagaagtcaacaccatgtgggaagaaggtgttctaccatggaagtctgcctcatgg
gttccaccatccagaagaggtgccaactacgacgctgaagaaatgactcacgatgacaag
ccattgtacaagagaatgttcagcaccaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YDR343C
Entry
YDR343C           CDS       T00005                                 

Gene name
HXT6
Definition
(RefSeq) hexose transporter HXT6
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR343C (HXT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR343C (HXT6)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDR343C (HXT6)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 851944
NCBI-ProteinID: NP_010630
SGD: S000002751
UniProt: P39003
LinkDB
Position
IV:complement(1159608..1161320)
AA seq 570 aa
MSQDAAIAEQTPVEHLSAVDSASHSVLSTPSNKAERDEIKAYGEGEEHEPVVEIPKRPAS
AYVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVS
IFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLG
VGGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGV
EAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSF
ETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIG
FFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASW
VPPSRRGANYDAEEMAHDDKPLYKRMFSTK
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgtcacaagacgctgctattgcagagcaaactcctgtggagcatctctctgctgttgac
tcagcctcccactcggttttatctacaccatcaaacaaggctgaaagagatgaaataaaa
gcttatggtgaaggtgaagagcacgaacctgtcgttgaaattccaaagagaccagcttct
gcctatgtcactgtctctattatgtgtatcatgatcgcctttggtggtttcgttttcggt
tgggatactggtaccatttctggtttcatcaatcaaaccgatttcatcagaagatttggt
atgaagcataaagatggtactaattatttgtctaaggttagaactggtttgattgtctcc
attttcaacattggttgtgccattggtggtattattctttccaaattgggtgatatgtac
ggtcgtaaggtgggtttgattgtcgttgttgtcatctacatcatcggtattattattcaa
attgcatctatcaacaaatggtaccaatatttcatcggtagaattatttccggtttgggt
gttggtggtattgccgttttatctcctatgttgatttctgaagtatccccaaagcattta
aggggtactttagtctcttgctaccaattgatgattactgccggtattttcttgggttac
tgtaccaacttcggtactaagaactactccaactctgtgcaatggagagttccattaggt
ttgtgttttgcctgggctttgtttatgattggtggtatgacatttgttccagagtctcca
cgttatttggctgaagtcggtaagatcgaagaagccaaacgttctattgccgtttctaac
aaggttgctgttgatgatccatctgttttggctgaagtcgaagctgtcttggctggtgta
gaggcagagaaattagctggtaatgcatcctggggtgaattgtttagtagcaagacaaag
gtccttcagcgtttgatcatgggtgctatgattcaatctctacaacaattgacaggtgat
aactatttcttctactatggtactactattttcaaggctgttggtttgagtgactctttc
gaaacctctattgtcttgggtattgttaactttgcttccacctttgttggtatttacgtt
gttgagagatatggtcgtcgtacttgtttgctatggggtgctgcatccatgactgcttgt
atggttgtctatgcttccgtgggtgtcaccagattatggccaaatggtcaagaccaacca
tcttccaagggtgctggtaactgtatgattgtctttgcctgtttctatattttctgtttt
gctactacatgggctccaattccttatgtcgttgtttctgaaactttcccattgagagtc
aagtctaaggctatgtctattgctacagctgctaattggttgtggggtttcttgattggt
ttcttcactccatttattactggtgctattaacttctactacggttacgttttcatgggc
tgtttggtcttcatgttcttctatgttttgttagttgttccagaaactaagggtttgact
ttggaagaagtcaacaccatgtgggaagaaggtgttctaccatggaagtctgcctcatgg
gttccaccatctagaagaggtgccaactacgacgctgaagaaatggctcacgatgataag
ccattgtacaagagaatgttcagcaccaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YDR345C
Entry
YDR345C           CDS       T00005                                 

Gene name
HXT3
Definition
(RefSeq) hexose transporter HXT3
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR345C (HXT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDR345C (HXT3)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YDR345C (HXT3)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 851946
NCBI-ProteinID: NP_010632
SGD: S000002753
UniProt: P32466
LinkDB
Position
IV:complement(1162957..1164660)
AA seq 567 aa
MNSTPDLISPQKSSENSNADLPSNSSQVMNMPEEKGVQDDFQAEADQVLTNPNTGKGAYV
TVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFN
IGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGG
IAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCF
AWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEA
RAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETS
IVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSK
GAGNCMIVFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFT
PFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPT
SQRGANYDADALMHDDQPFYKKMFGKK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaattcaactccagatttaatatctccacaaaagtcaagtgagaattcgaatgctgac
ctgccttcgaatagctctcaggtaatgaacatgcctgaagaaaaaggtgttcaagatgat
ttccaagctgaggccgaccaagtacttaccaacccaaatacaggtaaaggtgcatatgtc
actgtgtctatctgttgtgttatggttgccttcggtggtttcgttttcggttgggatact
ggtaccatttctggtttcgtcgcccaaactgatttcttgagaagattcggtatgaagcat
aaagatggtagttattatttgtctaaggttagaactggtttaattgtctccattttcaac
attggttgtgccattggtggtattattttggctaaattgggtgatatgtacggtcgtaaa
atgggtttgattgtcgttgttgttatctacatcatcggtattattattcaaattgcatcc
atcaacaaatggtaccaatatttcatcggtagaattatttccggtttgggtgttggtggt
attgccgttttatctcctatgttgatttctgaagtcgctcctaaggaaatgagaggtact
ttagtctcctgttaccaactgatgattaccttgggtattttcttgggttactgtaccaac
ttcggtactaagaactactccaactctgtgcaatggagagttccattaggtttgtgtttt
gcctgggctttgtttatgatcggtggtatgactttcgttccagaatccccacgttatttg
gttgaagctggtcaaattgacgaagcaagagcatctctttccaaagttaacaaggttgcc
ccagaccatccattcattcaacaagagttggaagttattgaagctagtgttgaagaagct
agagctgctggttcagcatcatggggtgagttgttcactggtaagccggccatgtttaag
cgtactatgatgggtatcatgatccaatctctacaacaattgactggtgataactatttc
ttctactatggtactaccgtttttaacgctgttggtatgagtgattctttcgaaacttct
attgttttcggtgtcgtcaacttcttctctacttgttgttctttgtacactgtcgatcgt
tttggacgtcgtaactgtttgttatatggtgccattggtatggtctgctgttatgtagtt
tacgcttctgttggtgtcaccagactatggccaaatggtgaaggtaatggttcatccaag
ggtgctggtaactgtatgattgtctttgcctgtttctatattttctgttttgctaccact
tgggctccaattgcttatgttgttatttctgaaactttcccattgagagtcaagtctaag
gctatgtctattgctacagctgctaattggttgtggggtttcttgattggtttcttcact
ccatttattactggtgctattaacttctactacggttacgttttcatgggctgtatggtt
ttcgcctacttctacgttttcttctttgtgccagaaactaagggtttgactttggaagaa
gtcaatgatatgtacgctgaaggtgttctaccatggaagtctgcttcatgggttccaaca
tctcaaagaggtgctaactacgatgctgatgcattgatgcatgatgaccagccattctac
aagaaaatgttcggcaagaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YEL069C
Entry
YEL069C           CDS       T00005                                 

Gene name
HXT13, HLT1
Definition
(RefSeq) hexose transporter HXT13
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YEL069C (HXT13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YEL069C (HXT13)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YEL069C (HXT13)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 Pox_A14
Other DBs
NCBI-GeneID: 856640
NCBI-ProteinID: NP_010845
SGD: S000000795
UniProt: P39924
LinkDB
Position
V:complement(21537..23231)
AA seq 564 aa
MSSAQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL
CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA
IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL
CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWAL
IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG
EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG
TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN
AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT
GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG
ISSEESKTEKKDWKKFLKFSKNSD
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgtctagtgcgcaatcctctattgatagcgatggagatgttcgagatgctgatattcat
gtcgcaccacccgtggaaaaagagtggtcagatggatttgatgacaacgaagtcataaac
ggggataacgttgagccaccaaaaagagggctcataggttatcttgtcatttacttactg
tgttatccaatatcctttgggggtttcctgcctggttgggatagtggtatcacagcaggt
ttcattaacatggacaactttaaaatgaacttcggttcttacaagcatagcactggtgaa
tattatttgagcaacgtgcgtatgggtcttcttgtggctatgttcagtattggatgtgcc
ataggtggccttatttttgcccgtcttgctgatactttaggtagaaggctggcaattgtg
atcgtggtgttggtatatatggttggtgcaattattcagatcagttcaaatcacaaatgg
taccagtactttgtcggtaagatcatctacggtcttggtgctggtggctgttcggtgttg
tgtccaatgcttttgtctgaaatagcccccacagatttgagaggtggactggtctcattg
taccaactgaacatgacgttcggtattttcttgggttattgtagcgtttatggtacgaga
aaatacgataacactgcacaatggagagtcccccttgggctttgctttttatgggctttg
attatcatcattggtatgttattggttccagagtccccaagatatctgattgaatgtgag
agacacgaagaggcccgtgcttccattgccaaaatcaacaaggtttcaccagaggatcca
tgggtactcaaacaggctgatgaaatcaacgccggtgtccttgcccaaagggaactagga
gaagcttcatggaaagaacttttctctgtaaaaactaaagtccttcaacgtttgatcaca
ggtattcttgtgcaaacctttttgcaacttactggtgaaaactacttcttcttctacgga
actaccatttttaaatcagtcggtcttactgatgggtttgagacgtcgatcgtcctaggt
acagtgaacttcttctccactattattgctgttatggtcgtagacaaaattggccgtcgt
aaatgtctgttatttggtgcagctgggatgatggcttgtatggtcatatttgcaagtatc
ggggtgaaatgtctttaccctcatggccaggacggtccttcttcgaaaggtgcaggtaat
gccatgattgtgttcacttgtttctatatattctgctttgcaacgacatgggctcctgtt
gcttatattgtggttgccgagtcgttcccttcgaaggtcaagtctagagccatgtcgatt
tcaactgcatgcaactggttatggcaatttttgatcggttttttcacaccattcattact
gggtctatccacttctattatggttatgtgttcgtaggttgtttggttgctatgtttttg
tacgttttcttctttttaccagaaacgattggtctatctttggaggaaatccaattacta
tacgaagaaggtataaaaccatggaaatctgcatcttgggtcccaccttctaggagaggt
atttcttccgaagaaagtaagaccgagaagaaggattggaagaaatttttgaagttctca
aagaattctgattga

KEGG   Saccharomyces cerevisiae (budding yeast): YFL011W
Entry
YFL011W           CDS       T00005                                 

Gene name
HXT10
Definition
(RefSeq) hexose transporter HXT10
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YFL011W (HXT10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YFL011W (HXT10)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YFL011W (HXT10)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 850536
NCBI-ProteinID: NP_116644
SGD: S000001883
UniProt: P43581
LinkDB
Position
VI:112345..113985
AA seq 546 aa
MVSSSVSILGTSAKASTSLSRKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGG
FIFGWDTGTISGFINQTDFKRRFGELQRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRL
GDIYGRKIGLMCVILVYVVGIVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEIS
PKHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMV
PESPRYLVEKGKYEEARRSLAKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFS
NKGAILPRVIMGIVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFV
ALYIVDKFGRRKCLLWGSASMAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFF
IFSFAITWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGY
VFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGGWIPSSRRTPQPTSSTPL
VIVDSK
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggttagttcaagtgtttccattttggggactagcgccaaggcatccacttctctaagt
agaaaggatgaaattaaactaacccctgaaacaagggaagctagcttggacattccatac
aaacccattattgcatactggacggtgatgggtctctgtctgatgattgcctttggtgga
ttcatttttggttgggatacaggaaccatttcagggtttattaaccaaacagatttcaag
agaaggtttggtgagttacaaagggacggcagttttcaactatcagatgtcaggacaggg
ctaattgtcggtatcttcaacataggttgtgctttaggtggcctaacgctgggacgcctg
ggcgatatttatgggcgtaaaatcggcttaatgtgtgttatactggtgtatgttgttggt
atcgtgatccagattgcttcctctgacaaatggtatcaatattttattggtagaattgtt
tctggaatgggtgttggaggtgttgctgtgctgtcgccaactttgatctcagaaatttcc
ccaaagcacctaagaggcacttgtgtctctttttaccagctaatgattacccttggaatt
ttcttgggctactgtaccaattatggtacaaagaaatattcaaattcaatacagtggcgg
gttcccttgggtttgtgttttgcgtgggcaatctttatggtgattggaatggttatggtt
ccggaatcgcccagatatttagtagaaaaaggtaagtatgaagaagctagaaggtctttg
gccaaatcaaacaaggtcacagttactgatccaggcgttgtttttgagtttgatactata
gttgcaaatatggaattagaaagggctgttggaaatgccagttggcacgaactcttctca
aataaaggagcaattctaccaagggtaataatgggaatcgttatccagtcactgcaacag
cttactggctgtaattattttttctactacggcacgaccattttcaatgctgttggaatg
caagactctttcgagacttccattgtccttggggctgttaattttgcttctacatttgtt
gcactatacattgtggataaatttgggcgtcgaaaatgtttattgtgggggtctgcctcg
atggcaatttgtttcgtcatattcgccaccgttggcgtcactagattatggccacaaggg
aaagaccaaccttcttcgcaaagtgctggtaatgttatgatcgtttttacttgtttcttc
attttctcttttgccattacttgggctcctatcgcctatgtcattgtggcagaaacttat
ccattaagagttaaaaatcgtgccatggccattgcggttggtgcgaactggatgtggggt
ttcttgattggatttttcacaccctttatcactagatccataggattttcttatggctat
gttttcatgggttgcttaatcttttcgtacttctacgttttcttctttgtttgcgaaaca
aagggattaactctggaggaagttaatgaaatgtacgaagaaagaataaagccatggaag
tccggaggttggattcccagttctagaagaacaccacaaccaacaagcagtacaccatta
gttattgttgatagtaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YHR092C
Entry
YHR092C           CDS       T00005                                 

Gene name
HXT4, LGT1, RAG1
Definition
(RefSeq) hexose transporter HXT4
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHR092C (HXT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YHR092C (HXT4)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YHR092C (HXT4)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 856492
NCBI-ProteinID: NP_011960
SGD: S000001134
UniProt: P32467
LinkDB
Position
VIII:complement(287081..288811)
AA seq 576 aa
MSEEAAYQEDTAVQNTPADALSPVESDSNSALSTPSNKAERDDMKDFDENHEESNNYVEI
PKKPASAYVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVR
TGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGR
IISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQ
WRVPLGLGFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVE
VVQATVEAEKLAGNASWGEIFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAV
GLEDSFETSIVLGIVNFASTFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWP
NGKKNGSSKGAGNCMIVFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWI
WGFLIGFFTPFISGAIDFYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLP
WKSPSWVPPNKRGTDYNADDLMHDDQPFYKKMFGKK
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgtctgaagaagctgcctatcaagaggatacagcagtccaaaatactccagctgatgct
ttgtcgccagttgaatccgattctaattccgctttgtctactccatccaacaaagctgaa
agagatgacatgaaagatttcgacgagaatcacgaagaatctaataactacgttgaaatt
ccaaagaagcccgcctccgcctacgttacagtttccatctgttgtttaatggttgctttc
ggtggttttgttttcggttgggatactggtaccatttctggttttgttgctcaaactgat
tttatcagaagatttggtatgaagcaccacgatggtacttattatttgtctaaggttaga
actggtttaattgtctccattttcaacattggttgtgccattggtggtattattttagca
aaattaggtgatatgtatggtcgtaaaatgggtttgattgtcgttgttgtcatctacatt
atcggtatcattatccaaattgcctcaatcaacaagtggtaccaatatttcattggtaga
attatctctggtttaggtgtcggtggtattgccgttttatctcctatgttgatttctgaa
gtctctccaaagcatattagaggtactttggtttcatgttaccaacttatgattactttg
ggtattttcttgggttactgtacaaactacggtaccaagacctacaccaattctgtccaa
tggagagttccattaggtctaggtttcgcttgggctttgtttatgattggtggtatgaca
ttcgttccagaatctccacgttatttagttgaagtcggtaaaattgaagaagctaagcgt
tctattgctctttcaaataaggtcagcgcagacgatccagctgttatggctgaagtcgaa
gttgttcaagctacagttgaagctgaaaaattagctggtaatgcctcctggggtgaaata
tttagcactaagactaaggttttccaacgtttgatcatgggtgctatgattcaatcattg
caacaattgacaggtgataactatttcttctattacggtactaccgttttcactgctgtc
ggtttggaagattcttttgaaacttctattgtcttgggtattgtcaactttgcttccacc
tttgttggtattttcttagtcgaaagatatggtcgtcgtagatgtttattatggggtgct
gcttccatgacagcttgtatggttgttttcgcttctgttggtgttacaagattgtggcca
aatggtaagaagaacgggtcttctaagggtgctggtaactgtatgattgtcttcacatgt
ttctacttattctgttttgccactacctgggctccaattccatttgttgttaactctgaa
actttcccattgagagttaagtccaagtgtatggctattgctcaagcttgtaactggatc
tggggtttcttgattggtttctttactccatttatttcaggtgctattgatttctactac
ggttatgttttcatgggctgtttggtcttttcttacttctacgtcttcttcttcgttcca
gaaactaaaggtttgactttagaagaagttaacaccttatgggaagaaggtgttttgcca
tggaaatcaccttcttgggttccaccaaacaagagaggtactgactacaacgctgatgat
ctaatgcatgatgatcaaccattttacaagaagatgttcggaaaaaagtag

KEGG   Saccharomyces cerevisiae (budding yeast): YHR094C
Entry
YHR094C           CDS       T00005                                 

Gene name
HXT1, HOR4
Definition
(RefSeq) hexose transporter HXT1
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHR094C (HXT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YHR094C (HXT1)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YHR094C (HXT1)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 856494
NCBI-ProteinID: NP_011962
SGD: S000001136
UniProt: P32465
LinkDB
Position
VIII:complement(290913..292625)
AA seq 570 aa
MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKG
VYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVS
IFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLG
VGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASV
EEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSF
ETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLIS
FFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASW
VPVSKRGADYNADDLMHDDQPFYKSLFSRK
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaattcaactcccgatctaatatctcctcagaaatccaattcatccaactcatatgaa
ttggaatctggtcgttcaaaggccatgaatactccagaaggtaaaaatgaaagttttcac
gacaacttaagtgaaagtcaagtgcaacccgccgttgcccctccaaacaccggaaaaggt
gtctacgtaacggtttctatctgttgtgttatggttgctttcggtggtttcatatttgga
tgggatactggtaccatttctggttttgttgctcaaactgattttctaagaagatttggt
atgaagcaccacgacggtagtcattacttgtccaaggtgagaactggtttaattgtctct
atttttaacattggttgtgccattggtggtatcgtcttagccaagctaggtgatatgtat
ggtcgtagaatcggtttgattgtcgttgtagtaatctacactatcggtatcattattcaa
atagcctcgatcaacaagtggtaccaatatttcattggtagaattatctctggtttaggt
gtcggtggtatcacagttttatctcccatgctaatatctgaggtcgcccccagtgaaatg
agaggcaccttggtttcatgttaccaagtcatgattactttaggtattttcttaggttac
tgtaccaattttggtaccaagaattactcaaactctgtccaatggagagttccattaggt
ttgtgtttcgcctgggccttatttatgattggtggtatgatgtttgttcctgaatctcca
cgttatttggttgaagctggcagaatcgacgaagccagggcttctttagctaaagttaac
aaatgcccacctgaccatccatacattcaatatgagttggaaactatcgaagccagtgtc
gaagaaatgagagccgctggtactgcatcttggggcgaattattcactggtaaaccagcc
atgtttcaacgtactatgatgggtatcatgattcaatctctacaacaattaactggtgat
aactatttcttctactacggtaccattgttttccaggctgtcggtttaagtgactctttt
gaaacttctattgtctttggtgtcgtcaacttcttctccacttgttgttctctgtacacc
gttgaccgttttggccgtcgtaactgtttgatgtggggtgctgtcggtatggtctgctgt
tatgttgtctatgcctctgttggtgttaccagattatggccaaacggtcaagatcaacca
tcttcaaagggtgctggtaactgtatgattgttttcgcatgtttctacattttctgtttc
gctactacctgggccccaattgcttacgttgttatttcagaatgtttcccattaagagtc
aaatccaagtgtatgtctattgccagtgctgctaactggatctggggtttcttgattagt
ttcttcaccccatttattactggtgccatcaacttctactacggttacgttttcatgggc
tgtatggttttcgcttacttttacgtctttttcttcgttccagaaactaaaggtttatca
ttagaagaagttaatgatatgtacgccgaaggtgttctaccatggaaatcagcttcctgg
gttccagtatccaagagaggcgctgactacaacgctgatgacctaatgcatgatgaccaa
ccattttacaagagtttgtttagcaggaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YHR096C
Entry
YHR096C           CDS       T00005                                 

Gene name
HXT5
Definition
(RefSeq) hexose transporter HXT5
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHR096C (HXT5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YHR096C (HXT5)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YHR096C (HXT5)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 856496
NCBI-ProteinID: NP_011964
SGD: S000001138
UniProt: P38695
LinkDB
Position
VIII:complement(294669..296447)
AA seq 592 aa
MSELENAHQGPLEGSATVSTNSNSYNEKSGNSTAPGTAGYNDNLAQAKPVSSYISHEGPP
KDELEELQKEVDKQLEKKSKSDLLFVSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRF
GSTRANGTTYLSDVRTGLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIII
QIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLG
YCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARA
NKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTG
DNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMIC
CYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLR
VRGKAMSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGL
TLEEVNEMYEENVLPWKSTKWIPPSRRTTDYDLDATRNDPRPFYKRMFTKEK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgtcggaacttgaaaacgctcatcaaggccccttggaagggtctgctactgtgagcaca
aattctaactcatacaacgagaagtcaggaaactcgactgctcctggtaccgccggttac
aacgataatttggcacaagctaaacccgtctcaagttacatttcccatgaaggccctccc
aaagacgaactggaagagcttcagaaggaggttgacaaacaactagagaagaaatcgaag
tcggatttactatttgtatccgtctgctgtttgatggttgcttttggtgggttcgtgttt
gggtgggatactggtactatatctggttttgtcaggcaaacagacttcattaggcgattt
ggcagcacccgtgcaaacgggactacctatctttccgatgtcagaaccggtttgatggtt
tctattttcaacatcggctgcgctatcggaggtatagttttgtcaaagctcggtgatatg
tatggacgtaagattggtctgatgactgttgtcgtcatttactcaattgggatcatcatc
caaatcgcctccattgacaaatggtatcaatatttcattggaagaatcatctcaggactg
ggcgttggtggtattacagttttggcgcctatgctaatttctgaagtgtcgcctaagcag
ttgcgtggtactctggtttcatgttaccaattaatgatcactttcggtatctttttggga
tattgtactaattttggtaccaagaattactcaaactctgtccaatggagggtaccatta
ggcttatgctttgcatggtctatttttatgattgttggtatgacgttcgttcctgaatcc
ccacgttatctggtagaagtgggaaaaattgaagaggccaagcggtccttagcaagagct
aacaaaaccactgaagactctcctttagtaactttagaaatggagaactatcagtcttct
attgaagctgagagattggcgggctctgcttcttggggggaattggttactggtaagccc
cagatgttcagacgtacactaatgggtatgatgattcaatctttacaacagctgacaggt
gacaattacttcttttactatggtactacaattttccaggctgttggtttggaagattca
tttgaaactgctattgttttgggtgttgttaattttgtttcgacttttttctcgctatat
accgtcgatcgttttggtcgtcgtaattgtttgttatggggctgtgtaggtatgatttgt
tgctatgtcgtctatgcctctgttggtgttaccagattatggccaaacggtcaagatcaa
ccatcttcaaagggtgctggtaactgtatgattgttttcgcatgtttctacattttctgt
ttcgctaccacttgggcccccgttgcctatgtccttatctctgagtcgtatcccttaaga
gtacgtggtaaagcaatgtcgattgcaagtgcctgtaactggatttgggggttcttgatc
agttttttcactccatttattacttcagcaatcaatttctattatggctatgtctttatg
ggttgtatggtgttcgcatacttttatgtgttcttctttgttccagagacaaagggctta
acattagaagaagtcaacgaaatgtatgaagaaaatgtgctaccttggaagtctaccaaa
tggatcccaccatctaggagaacaacagattatgacctagacgctactagaaatgatccg
agaccattttataaaaggatgttcactaaagaaaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YJL214W
Entry
YJL214W           CDS       T00005                                 

Gene name
HXT8
Definition
(RefSeq) hexose transporter HXT8
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJL214W (HXT8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJL214W (HXT8)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YJL214W (HXT8)
SSDB
Motif
Pfam: Sugar_tr MFS_1 CaKB
Other DBs
NCBI-GeneID: 853216
NCBI-ProteinID: NP_012321
SGD: S000003750
UniProt: P40886
LinkDB
Position
X:26887..28596
AA seq 569 aa
MTDRKTNLPEEPIFEEAEDDGCPSIENSSHLSVPTVEENKDFSEYNGEEAEEVVVPEKPA
SAYATVSIMCLCMAFGGFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLI
VSIFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAG
IGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVP
LGLCFAWAIIMIGGMTFVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDLLVA
GVEAEEAMGTASWKELFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMND
SFETSIVLGIVNFASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPNGKS
EPSSKGAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFL
IGFFTPFITSAINFYYGYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPWKSE
SWVPASRRDGDYDNEKLQHDEKPFYKRMF
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgactgatcgtaaaaccaacttgccagaagaaccgattttcgaagaggcagaagatgat
ggctgcccttcgatagaaaattcttcacatctgtcagtacctacagtggaggaaaacaag
gacttttccgagtataatggggaagaggcagaggaagttgttgttccagaaaagcctgct
tcagcctatgctactgtttctatcatgtgtttatgtatggctttcggtggatttatgtcc
ggttgggacacaggtacgatttctggtttcgtcaatcagactgattttttaagaagattt
ggtaattatagccattccaagaacacttactacttatctaatgtgagaactgggttgatt
gtgtccatcttcaatgtgggaagcgccattggctgtcttttcttgtctaaattgggtgat
atttacggccgctgcatgggtttgattatagttattgtcgtttatatggttggtattgtc
attcaaattgcctctatagataagtggtatcagtattttattggaagaattatcgctggt
ataggtgctggttccattagtgttcttgccccgatgcttatttcggaaactgcgccaaag
catatcagaggtacgttgctagcttgttggcaattgatggtgactttcgcaattttcttg
ggttattgtaccaattatggtaccaagacttactcgaattctgtccagtggcgtgttccg
cttggtctatgttttgcatgggctattattatgattggtggtatgacgtttgttccggaa
tctcctcggtttttggtgcaagtcggtaagattgagcaagctaaagcttcttttgccaag
tcgaacaagcttagtgttgacgatcctgctgtggttgcagagattgatcttcttgttgct
ggtgtggaggcagaagaagcaatgggaactgcttcatggaaggaattattttcgagaaag
actaaagtttttcaacgtttaacgatgacagtcatgattaactctctgcagcaactaacc
ggtgacaactatttcttctactacggtactactatcttcaaatctgtcggtatgaatgac
tcttttgagacttcaattgtcttgggtattgtgaattttgcttcttgcttcttttcactt
tattctgttgataagttgggccgtcgtagatgtcttttacttggagcagccaccatgacg
gcgtgcatggttatttacgcctccgttggcgtcacaagactatatccgaacggtaaaagt
gaaccatcatctaaaggtgctggtaattgtacgattgttttcacgtgtttttacattttc
tgcttttcctgcacctggggacctgtatgttatgtgattatttctgaaacatttccatta
agggtgagatccaagtgtatgtccgttgcaacagcggccaacttattgtgggggttccta
atcgggtttttcactccttttattacttcggcaattaatttctactacggttacgttttc
atgggttgcttagcgttttcatatttttacgtctttttctttgttccagaaacaaaaggt
ctaactttagaagaagttgatgagatgtggatggacggtgtattaccttggaaatctgaa
tcctgggtaccagcttctagaagggatggtgattatgataacgaaaaattacagcatgac
gagaaacccttctacaaaagaatgttttag

KEGG   Saccharomyces cerevisiae (budding yeast): YJL219W
Entry
YJL219W           CDS       T00005                                 

Gene name
HXT9
Definition
(RefSeq) hexose transporter HXT9
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJL219W (HXT9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJL219W (HXT9)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YJL219W (HXT9)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 853236
NCBI-ProteinID: NP_012316
SGD: S000003755
UniProt: P40885
LinkDB
Position
X:19497..21200
AA seq 567 aa
MSGVNNTSANDLSTTESNSNSVANAPSVKTEHNDSKNSLNLDATEPPIDLPQKPLSAYTT
VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNI
GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGI
AVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA
WTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKAGIELEK
LAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSI
IIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITS
QGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFF
TPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVP
PERRTADYDADAIDHDDRPIYKRFFSS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtccggtgttaataatacatccgcaaatgatttatccactaccgagtctaactctaac
tcagtagcaaatgcaccatctgtaaaaactgagcataatgactctaaaaactccctcaac
ctggatgccactgaaccacctattgacttacctcaaaaacccctctctgcatataccacc
gtcgcaatcctgtgtttgatgattgcatttggcggcttcatctttggttgggataccggt
accatttctggttttgttaacctttctgatttcatcagaaggttcggtcaaaaaaatgac
aagggaacctactacttatcgaaagtaagaatgggtttgatcgtctcaatattcaacatt
ggctgcgccataggcggaattgtcttgtcaaaagtcggtgatatatatggtcgtcgtatt
ggattgattacagttactgccatttacgttgtaggcatcctaatccaaataacttccata
aacaagtggtaccaatacttcattggaagaattatttctggcctaggagtgggaggcatt
gctgtcctttccccaatgttgatatctgaagttgctcccaaacaaatcagaggaaccctg
gtccaattgtaccagctgatgtgtacgatgggtatttttctaggatactgtaccaattac
ggtaccaagaactatcacaacgccactcaatggagagtcggccttggtctttgctttgcc
tggactacattcatggttagtggaatgatgtttgtaccagaatcaccacgttacctgatt
gaggttggtaaagatgaggaagcgaaacgttcactttcgaaatccaacaaagtctcagtc
gacgatccagccttgttagcagaatatgacactataaaggcgggaatcgaacttgaaaag
ctggcaggtaacgcatcatggtctgaactactctccactaaaacaaaggtctttcagcgt
gttctcatgggagtgatgatccaatcgctgcagcaattaaccggtgataactacttcttt
tactacggcaccaccatcttcaaatctgtcggtctaaaggactcctttcagacttcgatc
attatcggtgtggttaattttttctcttcattcatagcggtatacaccattgagaggttt
ggacgccgtacgtgtctattgtggggtgctgcttctatgctatgctgctttgctgtgttt
gcctccgtcggtgtgacaaagttgtggcctcaaggaagcagtcaccaagacattacttct
cagggcgccggtaactgtatgattgtgtttactatgttcttcattttttcgttcgccacc
acttgggcaggcggctgttacgttattgtctcagagacgtttcctcttagggtcaaatca
agaggaatggcaatcgcaacagctgcaaactggatgtggggtttcctgattagtttcttt
accccattcattaccggggcaatcaacttttactacggttatgtattcttaggctgtctg
gtttttgcatacttttatgtctttttctttgtcccagaaacaaaaggcctgacgctggag
gaggtgaatactatgtggctggaaggtgtgccagcatggaaatcagcctcatgggtgcca
ccagaaagaagaaccgcagattacgatgctgacgccatagaccatgacgatagaccaatc
tacaagaggttcttttccagctaa

KEGG   Saccharomyces cerevisiae (budding yeast): YJR158W
Entry
YJR158W           CDS       T00005                                 

Gene name
HXT16, HLT3
Definition
(RefSeq) hexose transporter HXT16
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJR158W (HXT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJR158W (HXT16)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YJR158W (HXT16)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Pox_A14
Other DBs
NCBI-GeneID: 853623
NCBI-ProteinID: NP_012692
SGD: S000003919
UniProt: P47185
LinkDB
Position
X:732440..734143
AA seq 567 aa
MASEQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLII
YLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV
GCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC
SVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFL
WALIIIVGMLLVPESPRYLIECERHEEACVSIAKIDKVSPEDPWVLKQADEINAGVLAQR
ELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI
VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKG
AGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTP
FITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEETQLLYEEGIKPWKSASWVPPS
RRGASSRETEAKKKSWKEVLKFPKSFN
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcaagcgaacagtcctcaccagaaattaatgcagataatctaaacagtagtgcagct
gacgttcatgtacagccacccggagagaaagaatggtcagacgggttttatgacaaagaa
gtcattaatggaaatacgccagacgcaccgaagagaggctttttaggttaccttattatc
tacttactatgctatcctgtatcctttggcggttttttacctggttgggatagtggtatt
actgcaggcttcatcaatatggataactttaaaatgaattttggttcttacaagcacagt
actggtgagtattatttgagcaacgtgcgtatgggtcttctcgtggccatgttcagtgta
ggatgttccattggcggtgttgcttttgcgagacttgctgatactttaggtagaaggcta
gcaattgtaatcgtggttttggtatatatggttggtgcaattattcagatcagttcgaat
cacaaatggtaccaatactttgtcggtaagatcatctacggtcttggtgctggtggctgt
tcggtgttgtgtccaatgcttttatctgaaatagcccccacagatttgagaggtggactt
gtctcattgtaccaacttaacatgaccttcggtattttcttgggttattgtagcgtttat
ggaacaaggaagtatagtaatactgcgcaatggaggattcctgtgggactatgctttctg
tgggctctaattatcatcgttggcatgttattagttccagagtccccaagatatctgatt
gaatgtgagagacatgaagaggcctgtgtctccatcgccaagatcgacaaggtttcacca
gaggatccatgggtactcaaacaggctgatgaaatcaacgccggtgtccttgcccaaaga
gaactaggggaagcctcatggaaagaacttttctccgtcaaaacaaaagtccttcaacgt
ttgatcacaggtattcttgtgcaaacctttttgcaacttactggtgaaaactacttcttc
ttctacggaactaccattttcaaatcagttgggcttactgatgggtttgagacttcgatc
gtcctaggtacagtgaatttcttctccactattattgctgttatggtcgtagacaaaata
ggccgtcgtaaatgtctgttattcggagcggcttcaatgatggcttgtatggtcatattt
gcaagtatcggggtaaaatgtctttaccctcatggccaggatggtccatcctcgaaaggt
gcaggtaatgccatgattgtgttcacatgcttctatatattctgctttgcaacgacatgg
gcccctgttgcttatattgtggttgccgagtcattcccttcgaaggtcaaatctaaagca
atgtcaatttcgactgcattcaactggttatggcaattcttgattggttttttcacacca
ttcattactgggtctatccacttctattatggttatgtgttcgtaggttgtttggttgct
atgtttttgtacgttttcttctttttaccagaaacaattggtctatctttggaggaaacc
cagttactatatgaagaaggtataaaaccatggaaatctgcatcttgggtaccaccctca
aggagaggagcttcttccagggaaactgaggctaagaagaaaagctggaaagaagttttg
aagttcccaaagagttttaattga

KEGG   Saccharomyces cerevisiae (budding yeast): YLR081W
Entry
YLR081W           CDS       T00005                                 

Gene name
GAL2
Definition
(RefSeq) galactose permease GAL2
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YLR081W (GAL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YLR081W (GAL2)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YLR081W (GAL2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF4118 LMF1
Other DBs
NCBI-GeneID: 850770
NCBI-ProteinID: NP_013182
SGD: S000004071
UniProt: P13181
LinkDB
Position
XII:290212..291936
AA seq 574 aa
MAVEENNMPVVSQQPQAGEDVISSLSKDSHLSAQSQKYSNDELKAGESGSEGSQSVPIEI
PKKPMSEYVTVSLLCLCVAFGGFMFGWDTGTISGFVVQTDFLRRFGMKHKDGTHYLSNVR
TGLIVAIFNIGCAFGGIILSKGGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGR
IISGLGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQ
WRVPLGLCFAWSLFMIGALTLVPESPRYLCEVNKVEDAKRSIAKSNKVSPEDPAVQAELD
LIMAGIEAEKLAGNASWGELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSV
GLDDSFETSIVIGVVNFASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYP
HGKSQPSSKGAGNCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWV
WGFLIAFFTPFITSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLP
WKSEGWIPSSRRGNNYDLEDLQHDDKPWYKAMLE
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcagttgaggagaacaatatgcctgttgtttcacagcaaccccaagctggtgaagac
gtgatctcttcactcagtaaagattcccatttaagcgcacaatctcaaaagtattctaat
gatgaattgaaagccggtgagtcagggtctgaaggctcccaaagtgttcctatagagata
cccaagaagcccatgtctgaatatgttaccgtttccttgctttgtttgtgtgttgccttc
ggcggcttcatgtttggctgggataccggtactatttctgggtttgttgtccaaacagac
tttttgagaaggtttggtatgaaacataaggatggtacccactatttgtcaaacgtcaga
acaggtttaatcgtcgccattttcaatattggctgtgcctttggtggtattatactttcc
aaaggtggagatatgtatggccgtaaaaagggtctttcgattgtcgtctcggtttatata
gttggtattatcattcaaattgcctctatcaacaagtggtaccaatatttcattggtaga
atcatatctggtttgggtgtcggcggcatcgccgtcttatgtcctatgttgatctctgaa
attgctccaaagcacttgagaggcacactagtttcttgttatcagctgatgattactgca
ggtatctttttgggctactgtactaattacggtacaaagagctattcgaactcagttcaa
tggagagttccattagggctatgtttcgcttggtcattatttatgattggcgctttgacg
ttagttcctgaatccccacgttatttatgtgaggtgaataaggtagaagacgccaagcgt
tccattgctaagtctaacaaggtgtcaccagaggatcctgccgtccaggcagagttagat
ctgatcatggccggtatagaagctgaaaaactggctggcaatgcgtcctggggggaatta
ttttccaccaagaccaaagtatttcaacgtttgttgatgggtgtgtttgttcaaatgttc
caacaattaaccggtaacaattattttttctactacggtaccgttattttcaagtcagtt
ggcctggatgattcctttgaaacatccattgtcattggtgtagtcaactttgcctccact
ttctttagtttgtggactgtcgaaaacttgggacatcgtaaatgtttacttttgggcgct
gccactatgatggcttgtatggtcatctacgcctctgttggtgttactagattatatcct
cacggtaaaagccagccatcttctaaaggtgccggtaactgtatgattgtctttacctgt
ttttatattttctgttatgccacaacctgggcgccagttgcctgggtcatcacagcagaa
tcattcccactgagagtcaagtcgaaatgtatggcgttggcctctgcttccaattgggta
tgggggttcttgattgcatttttcaccccattcatcacatctgccattaacttctactac
ggttatgtcttcatgggctgtttggttgccatgtttttttatgtctttttctttgttcca
gaaactaaaggcctatcgttagaagaaattcaagaattatgggaagaaggtgttttacct
tggaaatctgaaggctggattccttcatccagaagaggtaataattacgatttagaggat
ttacaacatgacgacaaaccgtggtacaaggccatgctagaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YMR011W
Entry
YMR011W           CDS       T00005                                 

Gene name
HXT2
Definition
(RefSeq) hexose transporter HXT2
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YMR011W (HXT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YMR011W (HXT2)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YMR011W (HXT2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 855023
NCBI-ProteinID: NP_013724
SGD: S000004613
UniProt: P23585
LinkDB
Position
XIII:288079..289704
AA seq 541 aa
MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC
LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG
GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP
TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM
IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA
SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV
NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM
IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA
IGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKRVSE
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtctgaattcgctactagccgcgttgaaagtggctctcaacaaacttctatccactct
actccgatagtgcagaaattagagacggatgaatctcctattcaaaccaaatctgaatac
actaacgctgaactcccagcaaagccaatcgccgcatattggactgttatctgtttatgt
ctaatgattgcatttggtgggtttgtctttggttgggatactggtaccatctctggtttt
gttaatcaaaccgatttcaaaagaagatttggtcaaatgaaatctgatggtacctattat
ctttcggacgtccggactggtttgatcgttggtatcttcaatattggttgtgcctttggt
gggttaaccttaggacgtctgggtgatatgtatggacgtagaattggtttgatgtgcgtc
gttctggtatacatcgttggtattgtgattcaaattgcttctagtgacaaatggtaccaa
tatttcattggtagaattatctctggtatgggtgtcggtggtattgctgtcctatctcca
actttgatttccgaaacagcaccaaaacacattagaggtacctgtgtttctttctatcag
ttaatgatcactctaggtattttcttaggttactgtaccaactatggtactaaagactac
tccaattcagttcaatggagagtgcctttgggtttgaactttgccttcgctattttcatg
atcgctggtatgctaatggttccagaatctccaagattcttagtcgaaaaaggcagatac
gaagacgctaaacgttctttggcaaaatctaacaaagtcaccattgaagatccaagtatt
gttgctgaaatggatacaattatggccaacgttgaaactgaaagattagccggtaacgct
tcttggggtgagttattctccaacaaaggtgctattttacctcgtgtgattatgggtatt
atgattcaatccttacaacaattaactggtaacaattacttcttctattatggtactact
attttcaacgccgtcggtatgaaagattctttccaaacttccatcgttttaggtatagtc
aacttcgcatccactttcgtggccttatacactgttgataaatttggtcgtcgtaagtgt
ctattgggtggttctgcttccatggccatttgttttgttatcttctctactgtcggtgtc
acaagcttatatccaaatggtaaagatcaaccatcttccaaggctgccggtaacgtcatg
attgtctttacctgtttattcattttcttcttcgctattagttgggccccaattgcctac
gttattgttgccgaatcctatcctttgcgtgtcaaaaatcgtgctatggctattgctgtt
ggtgccaactggatttggggtttcttgattggtttcttcactcccttcattacaagtgca
attggattttcatacgggtatgtcttcatgggctgtttggtattttcattcttctacgtg
tttttctttgtctgtgaaaccaagggcttaacattagaggaagttaatgaaatgtatgtt
gaaggtgtcaaaccatggaaatctggtagctggatctcaaaagaaaaaagagtttccgag
gaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL318C
Entry
YNL318C           CDS       T00005                                 

Gene name
HXT14
Definition
(RefSeq) Hxt14p
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YNL318C (HXT14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNL318C (HXT14)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YNL318C (HXT14)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 855398
NCBI-ProteinID: NP_014081
SGD: S000005262
UniProt: P42833
LinkDB
Position
XIV:complement(38707..40329)
AA seq 540 aa
MTAQIPYQHSSGYISHFHNNELDAGRGRDYNVTIKYLDDKEENIEGQAAKISHNASLHIP
VLLCLVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGL
IISIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVT
GIGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNI
AWQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEF
IDDLLENNYNNEETNNESKKQSLVKRNTFEFIMGKPKLWLRLIIGMMIMAFQQLSGINYF
FYYGTSVFKGVGIKDPYITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYMMT
YATVGTFGRETDFSNIVLIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFI
NWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEINKIFEPE
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgactgctcagattccgtatcaacatagctcgggatacatctctcattttcacaataat
gagcttgatgcaggcaggggaagggattataatgtaaccattaagtatctagatgataaa
gaagaaaatatagaaggccaagcagcaaagattagtcacaatgcgagtctgcatattccc
gttttattgtgcttggtaatctcgcttggtggctttatttttggatgggacattggaacc
atcggtggaatgacaaatatggttagctttcaagaaaaatttggcacaactaatattatc
catgacgatgaaacaatttttgtatctactaagaaacttactgatctgcaaataggccta
attatcagtatttttaacatcagttgtggcgtaggggctttaactctgtcaaaaatcggt
gattggattggtaggaaaggtggtatatggtttgccttagtagtgtactgcatcggtata
accattcaaattctctcctatggaaggtggtattttttgacattgggaagagccgtaacg
ggaatcggtgtgggagtaaccactgtcttggtgccaatgtttctctccgagaattctcca
ctaaaaatcagaggctccatggtatctacgtatcaattgattgtaacatttggcatacta
atgggaaacattttaaatttcatatgcgaaagatgttataaagatcctacacaaaatata
gcctggcaattgccattgttcttgggatacatttgggcaattataattggaatgtcactt
gtttacgttcctgaatctccacagtacttggcaaaaatcaaaaatgatgtgccctctgct
aaatactcttttgcgaggatgaatggcatccctgcgacggatagcatggtaattgaattc
atcgatgatttgctggaaaataactataataatgaggaaactaacaacgaatcaaaaaag
caaagcttagttaaaagaaacacatttgaatttattatgggaaagccaaagttatggttg
agactgattattggtatgatgataatggcatttcaacagctgtccggaataaattatttc
ttttattacggaacgtctgttttcaaaggtgtcgggattaaggatccttatattacttca
atcatactgtcaagtgttaacttcctttctacgatattaggcatatattacgtggagaaa
tggggccacaagacatgtttattatatggttcaacaaatttattattttatatgatgaca
tatgctactgtggggacatttggaagagaaacggacttctcaaatattgttttaattatc
gtgacttgttgttttattttttggtttgcaataacattgggcccagttacatttgtacta
gtgtccgaattgttccctctaagaacgagggccatatcaatggctatttgcacatttatc
aattggatgttcaatttcttaatatcacttttaacaccaatgattgtatccaaaattgat
ttcaaactaggatacatatttgctgcttgcctattagcgttgataatattcagttggata
ctagttcctgaaacgaggaaaaagaatgagcaagagatcaataaaatatttgaaccggag
tag

KEGG   Saccharomyces cerevisiae (budding yeast): YNR072W
Entry
YNR072W           CDS       T00005                                 

Gene name
HXT17, HLT4
Definition
(RefSeq) hexose transporter HXT17
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YNR072W (HXT17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YNR072W (HXT17)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YNR072W (HXT17)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 Pox_A14 Ni_hydr_CYTB
Other DBs
NCBI-GeneID: 855809
NCBI-ProteinID: NP_014470
SGD: S000005355
UniProt: P53631
LinkDB
Position
XIV:772657..774351
AA seq 564 aa
MQSSTESDRDIQDGPDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL
CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA
IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL
CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTL
IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG
EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG
TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN
AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT
GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG
IPSEESKTEKKDWKKFLKFSKGSD
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgcaatcatccactgaaagtgatagagatattcaggatggtcctgatgctgatattcac
gtcgcaccacccgtggaaaaagagtggtcagatggatttgatgacaacgaagtcataaac
ggggataacgttgagccaccaaaaagagggctcataggttatcttgtcatttacttattg
tgttatccaatatccttcgggggtttcctgcctggttgggatagtggtatcacagcaggt
ttcattaacatggacaactttaaaatgaacttcggttcttacaagcatagcactggtgaa
tattatttgagcaacgtgcgtatgggtcttcttgtggctatgttcagtattggatgtgcc
ataggtggtcttatttttgcccgtcttgctgatactttaggtagaaggctggcaattgta
atcgtggtgttggtatatatggttggtgcaattattcagatcagttcgaatcacaaatgg
taccaatacttcgttggtaagattatctatggtcttggtgctggtggctgttcggtgttg
tgtccaatgcttttgtctgaaatagctcctacagatttgagaggtggacttgtctcattg
taccaacttaacatgaccttcggtattttcttgggttattgtagcgtttatggtacgaga
aaatacgataacactgcacaatggagagtcccacttgggctttgctttttatggactttg
attatcatcattggtatgttattggttccagagtccccaagatatcttattgaatgtgag
agacacgaagaggcccgtgcttccattgccaaaatcaacaaggtttcaccagaggatcca
tgggtactcaaacaggctgatgaaatcaacgccggtgtccttgcccaaagagaactagga
gaagcttcatggaaagaacttttctccgtcaaaactaaagtccttcaacgtttgatcaca
ggtattcttgtgcaaacctttttgcaacttactggtgaaaactactttttcttctacgga
actaccattttcaaatcagtcggtcttactgatgggtttgagacgtcgatcgttctaggt
acagtgaacttcttttccactattattgctgttatggtcgtagacaaaattggccgtcgt
aaatgtcttttatttggtgcagctgggatgatggcttgtatggtcatatttgcaagtatc
ggggtgaaatgtctttaccctcatggccaggatggtccatcctcaaaaggtgcaggtaat
gccatgattgtgttcacttgcttctatatattttgctttgcaacgacatgggctcctgtt
gcttatattgtggttgccgagtcgttcccttcgaaggtcaaatctagggccatgtcgatt
tcgactgcatgcaactggttgtggcaatttttgatcgggtttttcacaccattcattact
gggtctatccacttctattatggttatgtgttcgtaggttgtttggttgcaatgtttctg
tacgttttcttctttttaccagaaacgattggtctatctttggaggaaatccaattacta
tatgaagaaggtataaaaccatggaaatctgcatcttgggtcccaccttctaggagaggt
attccttccgaagaaagtaagaccgagaagaaggattggaagaaatttttgaagttctca
aagggttctgattga

KEGG   Saccharomyces cerevisiae (budding yeast): YOL156W
Entry
YOL156W           CDS       T00005                                 

Gene name
HXT11, LGT3
Definition
(RefSeq) hexose transporter HXT11
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOL156W (HXT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOL156W (HXT11)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    YOL156W (HXT11)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 854009
NCBI-ProteinID: NP_014486
SGD: S000005516
UniProt: P54862
LinkDB
Position
XV:25273..26976
AA seq 567 aa
MSGVNNTSANELSTTMSNSNSAVGAPSVKTEHGDSKNSLNLDANEPPIDLPQKPLSAYTT
VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNI
GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGI
AVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA
WATFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEK
LAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSI
IIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITS
QGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFF
TPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVP
PERRTADYDADAIDHDNRPIYKRFFSS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtcaggtgttaataatacatccgcaaatgagttatctactaccatgtctaactctaac
tcagcagtaggcgctccctctgttaagactgaacacggtgactctaaaaattcccttaac
ctagatgccaatgagccacctattgacttacctcaaaaacccctctctgcgtataccacc
gtcgcaatcctgtgtttgatgattgcatttggcggcttcatctttggttgggataccggt
accatttctggttttgttaacctttctgatttcatcagaaggttcggtcaaaaaaatgac
aagggaacctactacttatcgaaagtaagaatgggtttgatcgtctcaatattcaacatt
ggctgcgccataggcggaattgtcttgtcaaaagtcggtgatatatatggtcgtcgtatt
ggattgattacagttactgccatttacgttgtaggcatcctaatccaaataacttccata
aacaagtggtaccaatacttcattggaagaattatttctggcctaggagtgggaggcatt
gctgtcctttccccaatgttgatatctgaagttgctcccaaacatatcagaggaactctg
gtccaattgtaccagctgatgggtacgatgggtatttttctaggatactgtaccaattac
ggtaccaagaactatcacaacgccactcaatggagagtcggccttggtctttgctttgcc
tgggctacattcatggttagtggaatgatgtttgtaccagaatcaccacgttacctgatt
gaggttggtaaagatgaggaagcgaaacgttcactatcgaaatccaacaaagtctcagtt
gacgatccagccttgctagttgaatatgacactataaaggcaggaattgaacttgaaaag
ctggcaggtaacgcatcatggtctgaactactctccactaaaacaaaggtctttcagcgt
gttctcatgggagtgatgatccaatcgctgcagcaattaaccggtgacaactacttcttt
tactacggtaccaccatcttcaaatctgtcggtctaaaggactcctttcagacttcgatc
attatcggtgtggttaattttttctcttcattcatagcggtatacaccattgagaggttt
ggacgccgtacgtgtctattgtggggtgctgcttctatgctatgctgctttgctgtgttt
gcctccgtcggtgtgacaaagttgtggcctcaaggaagcagtcaccaagacattacttct
cagggcgccggtaactgtatgattgtgtttactatgttcttcattttttcgttcgccacc
acttgggcaggcggctgttacgttattgtctcagagacgtttcctcttagggtcaaatca
agaggaatggcaatcgcaacagctgcaaactggatgtggggtttcctgattagtttcttt
accccattcattaccggggcaatcaacttttactacggttacgtattcttaggctgtctg
gtttttgcatacttttatgtctttttctttgtcccagaaacaaaaggcctgacactggag
gaggtgaatactatgtggctggaaggtgtgccagcatggaaatcggcctcatgggtgcca
ccggagagaagaaccgcagattacgatgctgatgcaatagatcatgacaatagaccaatt
tacaagaggttcttttccagctga

DBGET integrated database retrieval system