KEGG   Saccharomyces cerevisiae (budding yeast): YDL155W
Entry
YDL155W           CDS       T00005                                 

Gene name
CLB3
Definition
(RefSeq) B-type cyclin CLB3
  KO
K06659  G2/mitotic-specific cyclin 3/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL155W (CLB3)
   04113 Meiosis - yeast
    YDL155W (CLB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cwf_Cwc_15
Other DBs
NCBI-GeneID: 851400
NCBI-ProteinID: NP_010126
SGD: S000002314
UniProt: P24870
LinkDB
Position
IV:176773..178056
AA seq 427 aa
MHHNSQSLSSGHIRSPEDENVAPIGNLKHRTGSLSHISSAHPRVALSDVTNIVATNSSNN
SISKPKVAPIKERLDSAAIIEEERLDANSVAQRKEADHNDLLTDREQEEPVEDDGESEED
EEEDQEPLLLQHYASDTLVWEHAFRTYYRTTLDPNDDDVYDVVMVAELSNEIFEYMRKLE
DLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQLLPETLYLCINIIDRYLCKEVVPV
NKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDLLDAERTILNGLEFELGWPG
PMSFLRRISKADDYEHDTRTLAKYLLESTIMDHRLVSAQPSWLAAGAYFLSKIILGQNQW
SLAHVYYSNYTQEQILPLATIILENCRYASKRHNAIWRKYSSRRYLHSSQIVAKWIALAE
HRVERSN
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgcatcataactcacagtctttgagctctggacacatcaggagccccgaggatgaaaat
gtggcacctataggtaatcttaaacacaggactggatccctcagtcatatttcatctgcg
cacccgagggtcgcacttagcgacgttaccaatatagttgcgacaaactctagcaacaac
agcataagtaagccaaaagtcgccccaattaaagaaagattggattcagctgcgataatt
gaggaagaaaggctggatgcgaatagtgttgcacagagaaaagaagctgatcataacgat
ttgttaacggacagggaacaagaggaacccgttgaagacgacggagaaagcgaagaggat
gaagaagaagaccaggagcctctactgttgcaacattatgctagtgatacattggtctgg
gagcatgcatttagaacttactatagaactacattagatcccaatgatgatgacgtgtac
gatgtggtcatggttgccgaattatctaatgagatattcgagtatatgaggaaattggaa
gacctgtataaacccaacccgtactacatggataaacaaccagagttaagatggtcgttt
cgaagcacactgattgattggatcgtccaagtacatgaaaaatttcaacttttacctgaa
actctatatctctgcattaatataatagacagatatctgtgcaaagaagttgttcctgta
aataagttccaacttgtgggtgcagcctcactcttcattgctgctaaatatgaggaaatc
aactgtcctacaatcaaggatttcgtatacatgtcagaaaactgctactcaaggaacgac
ctgctggacgcagaaagaactattttgaacggcttagaatttgaattgggttggcctggt
ccgatgtcatttttacgaagaatcagtaaggcagacgattacgagcatgatacgagaaca
ctggccaaatatctattggaatccacaataatggaccatcgactggtttccgctcaacct
agttggttagctgccggtgcatactttctaagtaagattattctgggccaaaatcagtgg
tctctggcgcacgtctactattccaattatacacaagaacaaattcttccgttggccacc
attattttagaaaattgcagatatgcctctaaacgtcataacgccatatggagaaaatat
tcttcacgtcgttatttgcattcttcacagatcgtagcgaagtggatagcattagctgaa
cacagagtagaaagatctaactaa

KEGG   Saccharomyces cerevisiae (budding yeast): YLR210W
Entry
YLR210W           CDS       T00005                                 

Gene name
CLB4
Definition
(RefSeq) B-type cyclin CLB4
  KO
K06659  G2/mitotic-specific cyclin 3/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR210W (CLB4)
   04113 Meiosis - yeast
    YLR210W (CLB4)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF445
Other DBs
NCBI-GeneID: 850907
NCBI-ProteinID: NP_013311
SGD: S000004200
UniProt: P24871
LinkDB
Position
XII:562008..563390
AA seq 460 aa
MMLEGYTVQPPQSTLIGDIEIQDENANQEVKNVLYQGVQKGIKRLEKRQRRVALGDVTSQ
KANKIHNAIHNKFHQTKNNFEIENIRSSALVKEQQRDVRHEDSDYFLIDSSEGSSTDDEQ
VNEDAIDDLLSRRVNDQQIQADEVYEDFDGEMQDVIEEDVDSQIEPLSPINNDEIQTELD
RAFEKYFRSVPNPLDDDTHDVVMVVEYASDIFYYLRELEVKYRPNPYYMQNQVELTWPFR
RTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLVGVSALFIAAKFEEIN
CPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPMPFLRRISKADDYDFEPRTL
AKYLLETTIVEPKLVAAAPSWLAAGAYFLSRTILGSNDWSLKHVFYSGYTSSQIIPLASL
ILENCKNASRRHHSIWKKYFDQKHYRCSQIVEEWIVSTEA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgatgcttgaagggtatacggtacaacctccacagtctactttgataggtgacattgaa
attcaggacgaaaatgcaaaccaagaagttaagaacgtactttaccaaggagttcaaaag
ggtataaaaaggctagaaaaaagacaaaggagggttgcattaggtgatgtaacctctcaa
aaggcaaacaaaatacacaatgctatacataataaattccatcagacgaagaacaatttt
gaaatagagaacatacgctcatcggccttggtaaaagaacaacaacgagacgtaaggcat
gaagatagcgactattttttaattgatagttctgaaggctcttctactgatgacgaacaa
gttaatgaagatgctattgatgatttgttaagtcgaagagtaaatgatcagcagattcaa
gccgatgaagtgtatgaagatttcgatggagaaatgcaagatgtcattgaagaggatgtt
gatagtcaaattgaaccactatcaccaataaacaacgatgaaattcagactgagctggac
agggcgtttgaaaaatattttcggtcggttcccaatccgctggatgatgatacccatgat
gttgtgatggttgtggagtacgcttccgacatattctattacttgagagaacttgaagtg
aaatataggcctaatccctactatatgcaaaatcaagtagagcttacatggccgttcaga
cgaactatgatagattggctagttcaactgcattttagatttcaacttttaccagaaacg
ctatacctgacgattaatatagtggatagatttctgtcaaagaagaccgttactttgaac
aggtttcaattggttggtgtatcggctttatttattgctgccaagtttgaagagattaac
tgccccactttggatgatctagtttacatgctggaaaatacatacactagagatgacatt
attagagcggaacagtatatgatagatactctggaatttgaaataggttggccaggaccc
atgccatttttaagaaggataagtaaagcagatgactatgacttcgaaccaagaacatta
gcaaagtacttattggaaactacaatagtagaacccaaactagtggctgcggcaccaagc
tggttagctgctggcgcgtattttctgagcagaacaattcttggttcaaatgattggtct
ttaaaacatgtattctactctggctatacatccagccaaataattcctttagcatcactg
atattggagaattgcaagaacgcatctcgacgccatcattcaatttggaaaaaatacttt
gaccaaaagcattaccgctgttctcaaattgtagaagaatggattgtttcgacagaagcc
taa

DBGET integrated database retrieval system