KEGG   Saccharomyces cerevisiae (budding yeast): YDL164CHelp
Entry
YDL164C           CDS       T00005                                 

Gene name
CDC9, MMS8
Definition
(RefSeq) DNA ligase (ATP) CDC9
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YDL164C (CDC9)
   03410 Base excision repair
    YDL164C (CDC9)
   03420 Nucleotide excision repair
    YDL164C (CDC9)
   03430 Mismatch repair
    YDL164C (CDC9)
Enzymes [BR:sce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YDL164C (CDC9)
    6.5.1.6  DNA ligase (ATP or NAD+)
     YDL164C (CDC9)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     YDL164C (CDC9)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    YDL164C (CDC9)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     YDL164C (CDC9)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     YDL164C (CDC9)
   NER (nucleotide excision repair)
    Other NER factors
     YDL164C (CDC9)
   MMR (mismatch exicision repair)
    Other MMR factors
     YDL164C (CDC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 851391
NCBI-ProteinID: NP_010117
SGD: S000002323
UniProt: P04819
LinkDB All DBs
Position
IV:complement(164987..167254)
Genome map
AA seq 755 aa AA seqDB search
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK
KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP
QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG
EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagattactgaccggttgccttctttcatctgcacgtcccttgaaatcaagattg
ccattattgatgtcatcctcattaccttcctctgccggtaagaagcctaaacaagccact
ttggctagattcttcacttccatgaaaaataagccaacagaaggtactccttctcccaaa
aaatcatccaaacatatgctggaagatagaatggataatgttagtggggaagaggaatac
gcgaccaagaaattgaaacagacggctgttacacatactgtagcagctccaagctccatg
ggtagcaatttttcttctataccatcatccgctccctcttccggtgttgctgattcaccg
caacaatctcagaggttggtaggtgaagttgaagacgccttgagctcaaataataatgat
cactattcgtctaatatcccctattctgaagtttgtgaggtttttaacaagattgaggcc
atatcttcccgtttagagattataagaatctgttctgatttctttattaagataatgaag
caatcgtctaagaacttaatacctacaacataccttttcatcaatagattgggccctgac
tacgaagcaggcttggaattaggccttggagaaaatcttcttatgaaaaccataagcgaa
acttgcgggaaatccatgagccaaattaaacttaaatacaaggatattggggatttgggt
gaaatagcaatgggtgcgagaaatgtccaacccactatgtttaagcccaaacccttgacc
gtgggtgaggtcttcaaaaatcttagagctattgctaagactcagggcaaagattcacaa
ttaaaaaagatgaagctgatcaagagaatgcttactgcttgcaaaggtatagaggctaag
tttttgattagatccctagagtcaaaattgagaatcggtcttgctgaaaagactgtctta
atatccctatcgaaggctcttttgctccatgatgaaaatagggaggactctccagacaaa
gatgtccccatggatgtgttagaaagtgctcaacaaaagataagagacgcattttgtcaa
gtacccaactatgaaattgttataaactcatgcctggaacacggtattatgaatttagat
aaatattgtactctaagaccaggaattccattgaaacccatgttagccaagcctaccaag
gcaattaatgaagtattggatagatttcaaggcgaaacttttacgtcagaatacaaatac
gatggtgaaagggctcaggtgcatttactaaatgatggtacaatgaggatttattccaga
aatggcgagaatatgactgagagatatccagaaattaacataacggattttatccaggat
ttggatactaccaaaaatttaattctagactgtgaggctgttgcttgggacaaagatcag
gggaaaattttgcctttccaggtcttaagtacaaggaaacgtaaagacgtggagctgaat
gatgttaaagttaaagtctgtctctttgcatttgatatactttgctacaacgatgaaagg
ctgattaataagtcactaaaggaaagaagagaatacttgacgaaggttacaaaagttgtc
ccgggagaattccaatacgcgactcagataacaacaaataaccttgatgaacttcaaaaa
ttccttgatgagtccgttaatcactcatgcgaaggtttgatggtcaaaatgttggagggc
cctgaatcccattatgaaccaagtaaaaggtcaagaaactggttgaaattaaaaaaagat
tacttggagggggttggagattcattggatctctgcgtgttgggggcatattatggtaga
ggaaaaagaactggtacgtacggtgggttccttctaggatgttacaaccaagacacagga
gaatttgaaacttgttgcaagatagggacaggattttcggacgaaatgttgcagcttttg
cacgacaggttgaccccgacgatcattgatggaccaaaagccacgtttgttttcgattcg
agtgctgagccagatgtatggttcgaacctacgactttgtttgaagttttgactgcagac
ctttccctatcgcctatttataaagcaggtagtgcaacttttgataaaggcgtatcctta
agatttccaagatttttgcgtataagagaagacaagggcgtagaagatgcaacctcttct
gaccagatcgtcgaattgtatgaaaaccaatcccacatgcaaaattag

DBGET integrated database retrieval system