KEGG   Saccharomyces cerevisiae (budding yeast): YDR052C
Entry
YDR052C           CDS       T00005                                 

Gene name
DBF4, DNA52, LSD7
Definition
(RefSeq) protein serine/threonine kinase activating protein DBF4
  KO
K02309  regulatory subunit for Cdc7p protein kinase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR052C (DBF4)
   04113 Meiosis - yeast
    YDR052C (DBF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDR052C (DBF4)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    YDR052C (DBF4)
SSDB
Motif
Pfam: Dfp1_Him1_M zf-DBF HHH_8
Other DBs
NCBI-GeneID: 851623
NCBI-ProteinID: NP_010337
SGD: S000002459
UniProt: P32325
LinkDB
Structure
PDB: 
3OQ4 3QBZ 3OQ0

Position
IV:complement(558511..560625)
AA seq 704 aa
MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNCNNNNTTESFPKKRSL
ERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRVTPKELLEWQTNWKKIM
KRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITRRSVE
NIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSNLLHN
EKLYGPTDRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITLEWKPQELTNLDELPYPILK
IGSFGRCPFIGDRNYDESSYKRVVKRYSRDKANKKYALQLRALFQYHADTLLNTSSVNDQ
TKNLIFIPHTCNDSTKSFKKWMQEKAKNFEKTELKKTDDSAVQDVRNEHADQTDEKNSIL
LNETETKEPPLKEEKENKQSIAEESNKYPQRKELAATPKLNHPVLATFARQETEEVPDDL
CTLKTKSRQAFEIKASGAHQSNDVATSFGNGLGPTRASVMSKNMKSLSRLMVDRKLGVKQ
TNGNNKNYTATIATTAETSKENRHRLDFNALKKDEAPSKETGKDSAVHLETNRKPQNFPK
VATKSVSADSKVHNDIKITTTESPTASKKSTSTNVTLHFNAQTAQTAQPVKKETVKNSGY
CENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLRFQI
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggtttctccaacgaaaatgataataaggtctccgttaaaggaaacagataccaacttg
aaacataataatggaattgccgcatcaacaacagcagcgggccacttgaatgtgttttct
aacgacaataattgcaacaataacaataccactgaatcctttccgaagaaaagatctctt
gagcgcctcgagctccaacagcagcagcatttgcatgaaaagaaaagggccagaatagaa
agggccaggtctattgaaggcgctgtccaagtcagcaaaggtacgggtctgaaaaatgtc
gagccaagggttacgcctaaggaattgctggaatggcaaacaaattggaaaaagataatg
aaaagagattctcgcatttactttgacattactgatgatgtagagatgaatacatataat
aagtccaagatggacaaacgcagagatttattgaaaagagggtttcttacattgggtgcg
caaataactcaattttttgacactactgtcacaatagttatcacaagaaggtctgttgag
aacatatatttactaaaagataccgacattttatcgagagctaaaaaaaactacatgaaa
gtttggagttacgaaaaggctgccagatttctgaaaaatcttgatgttgatttggatcat
ttgagcaagactaaatctgcttctttagctgcgcccacattgtccaatcttctacacaat
gaaaaattatatggaccaacggatagagaccccagaactaaaagagacgatattcactac
tttaaatatcctcatgtatacctttatgacctatggcaaacttgggcccccataataact
ttggaatggaaacctcaagaactaacaaacttagacgaactaccttacccaatattgaaa
ataggttcattcggaagatgcccttttataggggataggaattatgacgaaagttcttat
aagcgcgtagtaaagagatactcgagagacaaagcaaacaaaaaatatgcactgcaactt
cgtgctctatttcaatatcatgccgacaccttactgaatacgtcatcagttaatgatcaa
acgaaaaacctaatattcatacctcacacatgcaacgattctaccaagagcttcaaaaaa
tggatgcaagaaaaggcaaaaaattttgagaagaccgagttaaagaagacggatgatagc
gcagttcaagatgttcgtaatgaacatgctgaccaaaccgatgaaaaaaatagtatatta
ttaaatgaaactgaaaccaaagagcctccgttgaaagaagaaaaagaaaataaacaatct
atagcagaagaatcgaataagtacccacagcgaaaagagctggctgccacaccaaaacta
aaccatccagtattagctacttttgcaaggcaagaaactgaagaagtgccggatgatttg
tgcactttgaaaacaaagtcacgtcaggcatttgaaatcaaagcaagtggtgcacatcaa
tctaatgatgtggcaacctcttttggcaatggtttgggcccaacaagagcaagcgtcatg
agtaagaacatgaagtcattaagtagactaatggttgatagaaagctgggagtaaagcag
acaaatggaaataacaaaaattatacagccactatagcaactactgctgaaacatcaaag
gaaaatagacacagattagattttaatgctttgaaaaaagacgaagccccttcgaaagag
acgggcaaagatagtgctgtacacttagaaactaatagaaagccccagaatttccctaag
gtagctaccaaatcagtctccgcagactccaaagttcataatgacatcaagataacaacc
acagaatctccaacagcatcgaagaaatcaacttccacaaacgtcaccttacattttaac
gcacagacagcacagacagcacagccggtgaagaaagaaacggtaaaaaattccggatac
tgtgaaaattgtcgtgtaaaatacgaatctttagaacaacacatagtttctgagaagcat
ttgtctttcgctgaaaacgatttaaattttgaggctattgactcgttaattgaaaatctc
agatttcaaatatag

DBGET integrated database retrieval system