KEGG   Saccharomyces cerevisiae (budding yeast): YDR069CHelp
Entry
YDR069C           CDS       T00005                                 

Gene name
DOA4, DOS1, MUT4, NPI2, SSV7, UBP4
Definition
(RefSeq) ubiquitin-specific protease DOA4
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDR069C (DOA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YDR069C (DOA4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR069C (DOA4)
   04121 Ubiquitin system [BR:sce04121]
    YDR069C (DOA4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YDR069C (DOA4)
Peptidases and inhibitors [BR:sce01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   YDR069C (DOA4)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Others
   Others
    YDR069C (DOA4)
Ubiquitin system [BR:sce04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    YDR069C (DOA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1 Rhodanese Vps39_2
Motif
Other DBs
NCBI-GeneID: 851641
NCBI-ProteinID: NP_010354
SGD: S000002476
UniProt: P32571
LinkDB All DBs
Position
IV:complement(584939..587719)
Genome map
AA seq 926 aa AA seqDB search
MEQNIISTIRDECIRHRSKYLTIAQLTAIAEAKINEFIITGKAKDQDLSSLLDKCIDILS
IYKKNSKDIKNIISCKNKGAMISSNSVMIIQLNYVYYKVIHIIVTTNIPHLSEFAKIKLH
KSTSDEGNGNNNNNEFQLMNIYNTLLETLLKDENIAKIKSFIKSSIKQTKLNHEQEECNL
MRTGSYITSNQLNSLISSSANSASSQMEILLIDIRSRLEFNKSHIDTKNIICLEPISFKM
SYSDHDLEKKSLITSPNSEIKMFQSRNLFKFIILYTDANEYNVKQQSVLLDILVNHSFEK
PISDDFTKIFILESGFPGWLKSNYGRQVSSSFPSNNNIKDDSVYINGNTSGLSLQHLPKM
SPSIRHSMDDSMKEMLVAPTPLNHLQQQQQQQSDNDHVLKRSSSFKKLFSNYTSPNPKNS
NSNLYSISSLSISSSPSPLPLHSPDPVKGNSLPINYPETPHLWKNSETDFMTNQREQLNH
NSFAHIAPINTKAITSPSRTATPKLQRFPQTISMNLNMNSNGHSSATSTIQPSCLSLSNN
DSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN
INSKLGSKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQ
EFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVD
LFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDE
QWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFDNLLNKNNDFVIYPFLLDLTPFWANDF
DGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTK
YKPVKNKADAINSNAYVLFYHRVYGV
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaatattattagtaccataagggatgagtgtattcgtcaccggtcgaagtac
cttacgatagcacaactaaccgctattgcagaggctaaaattaacgaattcatcataact
ggtaaggcaaaagatcaagatttgagcagtcttctagataaatgcatcgatattttatct
atttacaagaagaactcgaaagatatcaaaaatattatatcgtgcaaaaataagggtgca
atgattagttcaaattccgtaatgattattcaattaaattatgtttactacaaggtaatt
cacattattgtaacaaccaatattcctcatttaagtgaattcgccaagattaaattacat
aagagcacgagtgatgagggcaacggtaataacaacaataatgaatttcaactcatgaac
atttacaacactttgctggaaaccttattaaaagatgaaaacattgcaaaaataaaaagt
ttcattaagtcttccataaaacaaacaaaattgaaccatgagcaagaagaatgtaacctg
atgagaacgggttcctatatcacttccaatcaattaaactccctaataagttcatcagca
aattctgcttcctcccaaatggagatactactgatagatatacgatcaaggttggaattc
aacaagtcacatattgatacaaaaaatattatatgcctggagcctatttcttttaaaatg
tcatattcagatcatgatttggagaaaaaatcattaattacttctcctaatagtgagatt
aaaatgtttcaaagtagaaatcttttcaagtttatcattctctatacagacgcaaacgaa
tacaatgttaaacagcagtctgtcctgttggacattctggtgaatcattcctttgaaaaa
ccaatatccgatgactttaccaaaattttcattctggaatctggttttccaggttggctt
aagtcaaattatgggaggcaagtatcatcatcttttccatcaaataacaatattaaagat
gatagtgtttatattaatggtaacacttctggcctaagtttacaacatttacctaagatg
tctcccagtataagacattcaatggacgactctatgaaagaaatgctagttgcgcctact
ccattaaatcatcttcaacaacagcaacaacagcaatcagacaatgatcatgtgctaaaa
agatcttcaagtttcaaaaaattattctcaaattatacgtctcctaatccgaagaattca
aattcaaacttatattctatatcttcgttgtccatatctagttcaccatcgcctttacct
ctacattcgcctgacccagttaagggcaattcattgccaatcaattatccggaaacgcca
catctttggaaaaacagtgagacagattttatgacaaatcaaagagaacagttgaatcac
aactcttttgctcacatagctcctatcaacacgaaggccatcacttctccatcaagaact
gccacaccgaagttacaacgcttcccgcaaacaattagtatgaaccttaatatgaactcc
aatggacacagttctgccacctctaccattcaaccttcgtgtctatccttgtctaataat
gactctttagatcatacagatgttacaccaacttcttctcataattatgaccttgatttc
gcggttggtttggaaaatctaggaaattcgtgttacatgaactgtatcattcagtgtatc
ttaggtacacacgaattaacccaaatctttttggacgattcatatgctaaacacatcaat
attaatagtaagttgggatcgaaaggtattctggcaaaatattttgcaaggttggttcat
atgatgtataaggaacaggttgatggttcaaagaaaatttccatatcaccgataaaattt
aaattggcatgtggatctgttaactcattatttaagactgcatcccaacaggactgccaa
gagttttgccaattccttctagatggtcttcatgaagacttgaaccaatgcggttcaaac
ccacctttgaaggagctttctcaagaagctgaggcgagaagagaaaaactgtctttgcga
attgcctcgtcaattgagtgggaacgattcttgactactgatttcagtgttattgtcgac
ttatttcagggacaatacgcctcacgactaaaatgtaaagtctgtagtcatacctcgaca
acataccaaccttttacggtgctgtcaatccctattcctaaaaaaaattcccgaaataat
attaccattgaagattgtttcagagagttcaccaaatgtgagaacttggaagtggatgag
caatggttgtgcccacattgtgaaaaaaggcagccctccacgaaacaattgacaataacg
agattaccgaggaatctgatagtccatttaaagagatttgataatttattaaacaaaaat
aatgacttcgtcatatacccttttttgttggacttgactccattttgggccaatgatttt
gacggggtttttcctccaggtgttaatgacgatgaactaccaataaggggacaaatacca
ccttttaagtatgaattatatggtgtagcatgccactttggtactttgtatggtggtcat
tatacagcctatgtgaaaaagggattaaagaagggatggctatattttgatgataccaaa
tataaacctgtcaaaaacaaagccgatgcaattaactctaatgcatacgttttgttttat
caccgcgtctacggtgtttga

DBGET integrated database retrieval system