KEGG   Saccharomyces cerevisiae (budding yeast): YDR113C
Entry
YDR113C           CDS       T00005                                 

Gene name
PDS1
Definition
(RefSeq) securin
  KO
K02627  cell cycle regulator
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR113C (PDS1)
   04113 Meiosis - yeast
    YDR113C (PDS1)
SSDB
Motif
Pfam: Securin DUF5323
Other DBs
NCBI-GeneID: 851691
NCBI-ProteinID: NP_010398
SGD: S000002520
UniProt: P40316
LinkDB
Structure
PDB: 
5U1T 5U1S

Position
IV:complement(680496..681617)
AA seq 373 aa
MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNT
LKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL
SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADSG
KNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNST
KNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED
EDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMELVYSE
EGLDPEELEDLVT
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgatgccagctaacgaagataaagagaataatatcgtatatacagggaatgaaagttcc
ggcattaactttccacagacgccggctcacttgctgaaaaggtcgcactctaatatttta
aaaccacctgtaagattggaccaactcaaaagggatgcgaacagcaacaatggcaacaca
ttaaagtacatacaaggagggaaggaggtgtcacccacaaaaaggttgcatacccatgcg
caacaacaaggaagattgcctctggcagcaaaagacaacaatagatcgaaaagctttatt
tttcccgaaacttctaatcagagtaaagatgcagacttaccacaactacagaatacacta
tctatacgcaaaaacgaccaactcaggaaactttcgcaaatttctcgcagtcgtagtagg
gccaaccataatgatttgttaagcaattcaagaaagttacaaaagtacggttctgtcctt
ggttataatgctttacctaaaatgaaaagtctagttttaaaagatcttgcagattcaggt
aaaaatgaagagagttccgacgatgatgaaggtaatgaagattccgagagtaaacttggc
aaaaaactccaaagtgcacttttaaaacaggattcctccgacggtgaaaatgaattaaat
ggtggcctaggactatttaatgagcaaggtggtctgcaacaactcataaagaactccacg
aagaatgagcaaaaaactaaaaacgataaaagtgataaaactgatgactatgatatcgaa
atagcaccacagaggcaggagccgttaccgtatgtaccagaaggctattccccatttcaa
caagatgatattgaaaagctgaagacgttcaactcaccatataagcttgacttggaagac
gaagatgacaccccagataaagttgatttactcccactagaacaaattgatgaagaaggc
gaaaaagatgagactgagtgcatcactcggaatcaagaagaaggtgcagcgttaccactg
ctgtctaagaacttcaaagaagttgccgccgtcccaaccatggagttagtgtacagcgaa
gaaggcctcgatcctgaagaactagaggacttagttacttag

DBGET integrated database retrieval system