KEGG   Saccharomyces cerevisiae (budding yeast): YDR140WHelp
Entry
YDR140W           CDS       T00005                                 

Gene name
MTQ2
Definition
(RefSeq) S-adenosylmethionine-dependent methyltransferase
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     YDR140W (MTQ2)
Translation factors [BR:sce03012]
 Eukaryotic type
  Release factors
   YDR140W (MTQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_23 PrmA Methyltransf_12 Methyltransf_11 UPF0020 Methyltransf_25 PRMT5 Met_10 Methyltransf_18
Motif
Other DBs
NCBI-GeneID: 851718
NCBI-ProteinID: NP_010424
SGD: S000002547
UniProt: Q03920
LinkDB All DBs
Position
IV:734138..734803
Genome map
AA seq 221 aa AA seqDB search
MLPTPYVKCDYDKVYEPAEDSFLILDCLEKEHDFLKQKFGNRLAIVCEIGSGSGIVTTFL
MQNKIIPQENSIHLAVDINPWALEATLDTAKLNSCKSSFLEVIQADLNSSIRNNQVDVLI
FNPPYVPAECVPDVPGSREEADQWLDLALLGGKDGMAITDKLLRQLEQILSPDGVAYILF
CARNKPKEVIKRFVDTYKWNVKLIETRKAGWEVLSVYSFTR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgaccccttatgtaaaatgcgattacgataaagtatatgagcctgctgaggat
agcttcctcatactggactgtttggaaaaagagcatgattttttgaaacagaaatttggt
aatcgtttggccatcgtttgcgaaattggttcgggatcaggtatcgtcacaacatttcta
atgcaaaacaaaataataccgcaggaaaattccatccacttagctgttgatatcaaccca
tgggcgctcgaagcaactttggatactgcgaagttaaattcatgtaaaagttctttttta
gaagtgattcaagctgatttaaactccagtattcggaataatcaggttgatgtcctaata
tttaacccaccatatgtgccagcagaatgtgtgccagatgtcccaggatcaagagaggag
gcagaccaatggctagatttagcgttattgggtggaaaagacgggatggcgattactgat
aaactgctacgacaattagaacaaattctttctccagatggtgttgcatatatattattt
tgtgcaagaaataagcctaaagaagtcattaagaggtttgtcgatacttacaaatggaat
gtgaaacttattgaaacgagaaaagcgggatgggaagtcctcagtgtgtacagctttaca
aggtga

DBGET integrated database retrieval system