KEGG   Saccharomyces cerevisiae (budding yeast): YDR141CHelp
Entry
YDR141C           CDS       T00005                                 

Gene name
DOP1
Definition
(RefSeq) Dop1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 851719
NCBI-ProteinID: NP_010425
SGD: S000002548
UniProt: Q03921
LinkDB All DBs
Position
IV:complement(734901..739997)
Genome map
AA seq 1698 aa AA seqDB search
MSLPLKPLTIDSNNKQLDSKQKKFRANVERALERFDSVTEWADYIASLGTLLKALQSWSP
KFQNVRYYVPSPYQVSRRLTSSLSPALPAGVHQKTLEVYTYIFEHIGLETLATECNIWIP
GILPLMTYASMSVRSHLIELYDNYILLLPQTTLRLLIRPLISSLLPGIDDESNDFLPLTL
KLIETLQENLDDDSLFWQTLFLVMTANKGRRLGGLTWLTRKFPSLNAVPHLVNKIKMEAE
ENPSETETNDSHLDRKKRKEEAFKVLLPAAKDLVTPEPGLLIRCLVGCLEDENDILIKRS
VLDLLLQRLRLDSPVLNVLITSEDKKLLIMSCCRTTLSKDMSLNRRIWNWLLGPTAGGML
NNNGGNSMEYTTSVKSANEESNVYFTKYGLSALLEGLSDLLSEEESVLTAFRISMAVMDR
WEIGSLVIPELFIPLLYSSEKFKQNEQIMKTARTFFDNTETNIIWGKLFQELEDIKNLKI
LDFVLTNFNIGNDEEIIVRHLPLILLTLLALPSNDKDFDNIYKLQKFSLYNKLLNYIPER
ALLPLSHSKLKHDDEVSCEELLAKIRGFYTNVSNPSSILEKENIAERLPPFTTEDLTFLI
ADLIQKKLLSSLWDLENINESSKLFIAIFEKIPESEELKGRSHISWSDKKITQSIFEAIP
RLCESNNDAKSEEIVGIVEIFGNYLYSRMEFIESMKLLKVVMMAVWKSLKDPRHQILGVK
NLKTLNRFIPSKFIESALVYTFVEEEDISERLSVLDLLWTQLDSDSNLIRRPLELILGEL
FDDQNPFYLTVSKWILSILNSGSASRLFYILTDNILKVNRLEKERLDERDDLDMLTYEFQ
MLAYVLKTNNGRTRKVFSTELTSIKSSTIWKNEDVSTYKSLLLVTLMRFLNIKSNTHAKS
IRSALILLDILLDGTEQNFKDIVIFLLQMSSKYIAEEGIEPELIAVSLLDIVSKVLRLSH
DNGIKLDIFDDNAAHLKYIDFLVTSVSNMKSPLIVTAYVKLLSESIVYFENSIFRMILPL
SASLVQCVQRLFLLEKREGGYYQPIALLLGGLEELLEISHGYLVTEEREGYFSGSNLKGD
FIQSVVSNVFSSDSSNEESKIQGERDVILQSFRQVISCCLDIWYWAHNISCKSNDDSSLD
ATNHNSYKFKFRSKKLLETLFLLEPLELLENLISIRSDNTTVTLVHVLDGNKPAITIPHL
LYGVIIRYNRTASVKFSNRDGSRSSTTKLTKGEPSMLKRLSGESIIAFLFNYVDSVENSA
MEEFYGDFLLFFREVATNYNLYSDVSLSILKLVALISGKVSKTQFGEQKRVRREISDVFF
KYLPNAFINFTNLYRGHPDSFKDLEFVVWRVQYIVNDQIGGDKFNTTLATIVNQCLTPYI
KPKSEKTIPGYVLELAAVVSHLGSKVKSWRLLIAELFQNDKKLSVIGSDQTWEKIIYEWS
IYPENKSKILNDLLLEIGSKRSSVTPTLITFNLGSDSEVEYKCQNLLKISYLLMVSPNDA
YLLHFSSLISCIFHYLVSKDIKLKGSCWILLRVLLLRFSESHFNDYWSMISYCLQTNLQE
FYESLQIQSEVDPQTILQVCKTLDLLLLLNMEGFTSTNEWIFVIDTINCVYKTNSFVALV
DEIAEFKDYEITKTDDLELPTTLKDGLPLLRGIHKIERHTQLRSFFQNLSYLHYEKVYGL
GSVDLYGCGEDLKKDILS
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgtccttaccactaaagccccttacaattgactcaaataataaacaactagactccaaa
cagaagaagtttcgtgctaatgtcgagcgagcattagaaagatttgactctgtaacagaa
tgggcggactatattgctagtttgggaacactattaaaggcgttgcaaagctggtcacct
aaatttcagaatgtaaggtactatgttccttctccatatcaagtaagtcgaagattgaca
tcctcattatcgccggcgttaccagcaggtgttcatcagaaaactttagaagtatatacg
tatatctttgaacatattggccttgaaactctggctacagaatgtaacatttggatcccg
ggaattttacctttgatgacttatgcctctatgtctgttaggtcacatttgatagagctt
tacgataactatatccttctgttgcctcaaacaacgttaagactgctcatcagacctttg
atttctagtttattgccaggaattgatgatgaaagcaacgattttttacctttaacttta
aaactcattgagactctgcaggagaacttggatgatgattccttattttggcaaacgttg
tttctagtcatgactgcaaataaaggcagaagactgggcggactcacgtggttgactaga
aagtttccgtcgttgaatgctgtacctcatctagtaaataaaataaaaatggaagcggaa
gagaacccaagtgaaactgaaaccaacgattctcatctagacaggaaaaaaagaaaagaa
gaagctttcaaggtcttattgcctgctgccaaagatttagtaacccctgaaccaggtcta
cttatccgatgccttgtcggttgtttagaagatgaaaatgatattcttattaaaaggagc
gttttggaccttttattacagaggttgaggctagactctcccgttttgaatgttcttatt
acttctgaggataaaaagttattgataatgagttgttgtagaactactttgagcaaggat
atgtctttgaacagaagaatatggaactggcttctcggtcctactgctgggggcatgcta
aacaataacggcgggaactccatggaatatactacctcggttaagtcagcaaacgaggaa
agtaatgtatattttacaaaatatggattaagcgcccttttagaaggtttaagcgacctt
ctttcagaagaagaatccgtgttaactgcattcaggataagtatggcagtaatggataga
tgggaaattggctcacttgtaattcctgaattgttcatcccacttctctattcctcggaa
aaatttaaacaaaacgaacaaataatgaaaacggcacgtactttctttgacaatactgaa
acaaatattatatggggaaagctatttcaagaacttgaagacatcaaaaacctaaaaatt
ttggatttcgtattaacaaattttaatattggaaacgacgaagagattatcgtacgccac
cttcctttgatattattaactttactggcccttccatctaatgataaagatttcgacaat
atttataagctccaaaaattttctttgtacaacaaattgttaaactatatccccgagaga
gcccttctccctctcagtcactcaaaactaaagcacgatgatgaagtaagctgcgaagaa
cttttggccaaaatacgtgggttttataccaatgtttctaatccatctagcattttagag
aaagaaaatatagctgagcgtttgccaccctttacaacagaagatctaacttttttaata
gcagacctgattcagaagaagcttctttcaagtttatgggacttggaaaatatcaatgaa
agctccaaattatttatagctattttcgaaaagatacctgagtctgaagaacttaaagga
cgatctcacataagctggtcggataaaaaaataactcagagcatatttgaggctattccc
aggctttgtgaatctaataatgatgcaaaatcagaagaaatcgttggaattgtggaaatt
tttggtaactacttatattcacgcatggaattcattgaatcgatgaaattattgaaagta
gtcatgatggccgtatggaaatctttaaaagatccacgccatcaaatactaggtgtcaag
aacttaaagactttaaacagatttattccatccaaatttattgaaagtgcgttagtgtat
acttttgtggaagaggaagatatatccgagagattaagcgtgttagatctgttatggaca
caattagactcagattcaaacttgattaggcgccctcttgaattaattttgggcgaactt
tttgatgaccagaatcctttttatttaaccgtttcaaagtggattttatcgatattaaac
tcgggatctgcttcaagattattttacattttgactgataatattttaaaggttaatcgt
ctcgaaaaagaaagattagacgaaagggatgatcttgatatgctcacatatgagttccaa
atgcttgcttatgttttgaaaacaaacaatggacgcactaggaaagttttttccactgag
cttacctcaataaaatcttcgaccatatggaagaatgaagacgtttccacatataaaagt
ttgctgttggttacattgatgagatttctaaatataaagagcaatacacatgcgaaaagt
atcaggagtgctctgattcttttggatatcttactcgatggaactgagcaaaatttcaag
gacattgtcatatttttgctgcaaatgtcgtctaaatatattgcagaagaaggaattgag
cccgagttaatagcagtttccttgttagatattgtatcgaaggttctcagactatcacac
gataatggtattaaactagacatttttgatgacaatgctgcccatttaaaatatatcgat
ttccttgttaccagcgtttcaaatatgaaaagccctcttattgtaacggcctatgtgaag
cttctttccgaaagcattgtttattttgagaattctatatttcgaatgattttaccattg
tctgcatctcttgtacagtgtgttcagagattgtttttgctagaaaagagagaaggtggt
tattaccaaccaatagctttgcttctgggtggtctggaagagctattagagatttcacat
ggttaccttgtcaccgaggaaagggaaggatacttttctgggtctaatctaaagggtgat
tttattcaatccgttgtttcaaacgttttttcgtcagattcttccaatgaagaaagtaag
attcagggggaaagagacgtaatactacaatctttcagacaggtgatttcatgctgttta
gatatctggtattgggcccataacatttcgtgtaaatctaacgatgattctagcctggac
gccactaatcataactcatacaagttcaaatttaggtcgaagaaactgttggaaacctta
tttctactagaacctttggaacttctggaaaatttgatcagcattagatcagacaatact
acagtcacactagtacatgtgctcgacggcaataaacccgccattacaataccacattta
ttgtatggtgtaattatcagatacaacagaacggcatctgtcaagttttctaatcgtgac
ggaagtaggtcaagcacaactaaattaactaaaggggagccttccatgttaaaaagatta
agcggggaatcgattattgcatttttgtttaactacgtggattctgtagaaaactctgca
atggaggagttttatggggatttcctgctatttttcagagaagtagcaaccaattataac
ctttattctgatgtttcgttgtctatattaaaacttgttgcccttatttctggaaaagta
agtaaaacgcagtttggagaacaaaaacgagttaggagggagatatctgatgtgtttttc
aaatacctacctaatgcatttataaactttacgaacttatatcgtggccaccctgattca
tttaaagatttagaatttgtagtatggcgtgttcaatatatcgtcaacgatcaaattgga
ggagacaagtttaatacaacgttagcgacaattgtaaatcaatgcctaaccccttatatc
aaacccaaaagtgaaaaaactattccaggttatgtcttagaattggccgcggtcgtatcc
catttaggttcaaaagttaaaagttggaggcttttaattgcggaattgttccaaaatgac
aaaaaactttcggtaattggcagcgatcaaacttgggaaaagattatttacgaatggtcc
atttatccagaaaataagtcaaaaatcttgaacgatttactattagaaattggctccaag
cgttcaagtgtgactccgactttaatcacgtttaacttaggaagcgattctgaagtcgag
tacaagtgccaaaaccttttgaaaatatcgtacttgttgatggtatcgccaaatgacgca
tatttgttgcacttttcctctttaataagttgcattttccactatttggtgtccaaagat
atcaagctcaagggaagctgctggatcttactaagggttttacttttaagattttcagag
tcccatttcaatgactattggtctatgatcagttactgtttacaaactaatttgcaagaa
ttttatgaatcacttcaaatacagtcagaagtcgatccacaaacaatattgcaagtatgt
aaaactttggatttgctactcttactcaacatggaaggcttcacctctacgaatgagtgg
atctttgttattgatacaataaattgcgtatataaaacgaactcattcgtcgcgctggta
gatgaaatcgcagaattcaaagattacgaaataaccaaaactgatgatcttgaattaccg
acaactttaaaagatggtctcccattattacgaggcattcacaaaatcgagagacacacg
caactaagaagcttcttccagaatttgagttatctacattatgagaaagtttacggacta
gggtcagttgatttatatggttgtggtgaagatctcaaaaaagatattctgtcatga

DBGET integrated database retrieval system