KEGG   Saccharomyces cerevisiae (budding yeast): YDR142CHelp
Entry
YDR142C           CDS       T00005                                 

Gene name
PEX7, PAS7, PEB1
Definition
(RefSeq) Pex7p
  KO
K13341  peroxin-7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YDR142C (PEX7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 851720
NCBI-ProteinID: NP_010426
SGD: S000002549
UniProt: P39108
LinkDB All DBs
Structure
PDB: 

Position
IV:complement(740473..741600)
Genome map
AA seq 375 aa AA seqDB search
MLRYHMQGFSGYGVQYSPFFDNRLAVAAGSNFGLVGNGKLFILEIDRSGRIVEVNSFLTQ
DCLFDLAWNESHENQVLVAQGDGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNF
LSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQA
QFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVATGG
VDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILM
SASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSLWGKPGYVA
STAWDGNLFVWNGLG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctcagatatcatatgcaaggttttagtgggtacggtgtccagtattctccctttttc
gataacaggctcgcggtagctgctggttcaaactttggcctggttgggaatggaaaattg
ttcatccttgagattgatcgttcaggtagaatagtggaagttaattcctttttaacacag
gattgtttatttgatcttgcatggaacgaaagtcatgaaaaccaagtgttggttgcacag
ggcgatggtacattacgcttgtttgatacaacctttaaagagtttcctattgctatattt
aaagagcatgaacgagaagtattcagttgtaattggaacttagtcaacaggcagaatttc
ttaagtagttcatgggatggatctataaaaatatggtcccctctaagaaagcaaagttta
atgacccttactccacgacctttagagattaccaaaatggtggatccattaaacgccatt
atattgaaaaagaaaagctttacaggtatttcaaaaaacaggaactgtgtataccaagca
cagttctcgccccacgaccaaaatctcgtattatcctgttcagggaattcttatgcaagc
ttatttgacattagactaccttccggcaaaaatcagaataattttttagtgcattcagga
ctagaagcattgacttgcgatttcaacaaatacagaccttatgtagttgccacaggaggt
gtagataatgccattagaatctgggacattaggatgctaaataaaaatgaatcagcgact
atcaagaggactgtgcccggccaacttcacaattcatcatgcatcaatgaaatccctaat
gcgcacgggctggcaatcagaaaagttacctggtcccctcatcattccaatattttaatg
tcagcttcatatgatatgacctgtcgaatatggagagatctcagcaacgatggtgcaaaa
gaaacatataaaactaactctacggatgctactaaaggttccattttcaatttcacacag
cattcagaattcgtatttggagctgactggagcttgtggggaaagccaggatatgtggct
tcaactgcatgggatggaaatttatttgtatggaacggcttaggttga

DBGET integrated database retrieval system