KEGG   Saccharomyces cerevisiae (budding yeast): YDR217C
Entry
YDR217C           CDS       T00005                                 

Gene name
RAD9
Definition
(RefSeq) chromatin-binding protein RAD9
  KO
K06661  DNA repair protein RAD9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR217C (RAD9)
   04113 Meiosis - yeast
    YDR217C (RAD9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR217C (RAD9)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    YDR217C (RAD9)
SSDB
Motif
Pfam: Rad9_Rad53_bind BRCT BRCT_2 RTT107_BRCT_5 DUF5741
Other DBs
NCBI-GeneID: 851803
NCBI-ProteinID: NP_010503
SGD: S000002625
UniProt: P14737
LinkDB
Position
IV:complement(899551..903480)
AA seq 1309 aa
MSGQLVQWKSSPDRVTQSAIKEALHSPLADGDMNEMNVPVDPLENKVNSTNIIEGSPKAN
PNPVKFMNTSEIFQKSLGLLDESPRHDDELNIEVGDNDRPNANILHNERTPDLDRIANFF
KSNRTPGKENLLTKYQSSDLEDTPLMLRKKMTFQTPTDPLEQKTFKKLKSDTGFCYYGEQ
NDGEENASLEVTEADATFVQMAERSADNYDCALEGIVTPKRYKDELSKSGGMQDERVQKT
QIMISAESPNSISSYDKNKITGNGRTTRNVNKVFNNNEDNIGAIEEKNPVKKKSENYSSD
DLRERNNQIIQSNESEEINELEKNLNVSGRENDVNNLDIDINSAVSGTPSRNNAEEEMYS
SESVNNREPSKKWIFRYSKDKTENNSNRSTQIVNNPRTQEMPLDSISIDTQPLSKSFNTE
TNNELETQIIVSSLSQGISAQKGPVFHSTGQTEEIKTQIINSPEQNALNATFETPVTLSR
INFEPILEVPETSSPSKNTMSKPSNSSPIPKEKDTFNIHEREVETNNVFSNDIQNSSNAA
TRDDIIIAGSSDFNEQKEITDRIYLQLSGKQISDSGSDETERMSPNELDTKKESTIMSEV
ELTQELPEVEEQQDLQTSPKKLVVEEETLMEIKKSKGNSLQLHDDNKECNSDKQDGTESL
DVALIEHESKGQSSELQKNLMQLFPSESQEIIQNRRTIKRRQKDTIEIGEEEENRSTKTS
PTKHLKRNSDLDAASIKREPSCSITIQTGETGSGKDSKEQSYVFPEGIRTADNSFLSKDD
IIFGNAVWCQYTWNYKFYPGILLEVDTNQDGCWIYFETGRSLTKDEDIYYLDIRIGDAVT
FDGNEYVVVGLECRSHDLNIIRCIRGYDTVHLKKKNASGLLGKRTLIKALSSISLDLSEW
AKRAKIILEDNEKNKGDAYRYLRHPIRGRKSMTNVLSPKKHTDDEKDINTHTEVYNNEIE
SSSEKKEIVKKDSRDALAEHAGAPSLLFSSGEIRTGNVFDKCIFVLTSLFENREELRQTI
ESQGGTVIESGFSTLFNFTHPLAKSLVNKGNTDNIRELALKLAWKPHSLFADCRFACLIT
KRHLRSLKYLETLALGWPTLHWKFISACIEKKRIVPHLIYQYLLPSGESFRLSLDSPSKG
GIIKSNNIFSFYTQFLRGSNLRDQICGVKKMLNDYIVIVWGRSELDSFVKFAFACLSAGR
MLTIDLPNIDVDDTEPLLNALDSLVPRIGSELSNRKLKFLIYANENNGKSQMKLLERLRS
QISLKFKKFNYIFHTESKEWLIQTIINEDTGFHDDITDNDIYNTISEVR
NT seq 3930 nt   +upstreamnt  +downstreamnt
atgtcaggccagttagttcaatggaaaagctctccagatcgagtcacccaaagcgctata
aaggaagcactgcattctcccttggctgatggcgacatgaacgaaatgaatgttcccgtt
gatccgttggaaaacaaggtaaatagcacaaacataatcgaaggaagtcccaaagcaaat
ccaaatcctgtcaagtttatgaatacaagtgagatatttcaaaaatctctgggattactt
gacgagagtccaagacatgatgatgagttaaatattgaagtaggagataatgatcgacca
aatgctaacatattgcataatgaaaggactcctgaccttgaccgaattgctaactttttc
aaaagcaatcgaacccctggtaaagaaaatcttttgaccaaatatcaaagctccgatctg
gaagacactcctctgatgttaagaaaaaaaatgacttttcaaactccaactgatccattg
gaacagaaaaccttcaaaaagttgaagtcagatactgggttttgctattatggagagcag
aatgatggagaagaaaatgcgtcattagaagttacagaggcggatgccacttttgtacag
atggctgaacgttctgctgataattatgactgtgcattggaaggaattgttacacctaaa
agatataaagacgaattaagtaaaagtggaggaatgcaagatgaacgagttcaaaaaact
caaatcatgatatcagcagaatcacctaattcgataagctcttatgacaagaacaaaatt
accgggaatggccggaccacaagaaatgtaaacaaggtttttaacaataacgaagataac
ataggagctatcgaggaaaaaaatccagtaaaaaagaaaagtgagaactattcatcagat
gatctcagagaacggaacaatcaaataatacaaagtaatgaatcagaggagattaacgaa
ttggaaaagaatctgaatgtttcgggtagagagaatgacgtgaacaatttagatatcgat
attaatagtgctgtgtctggcaccccttcacgcaacaatgcggaagaagaaatgtattcc
agtgagagtgtaaacaatcgggaaccatccaagaagtggatattccgatactcaaaagac
aaaacggaaaataatagcaatagatctacgcaaatagtcaataatccaagaacacaggaa
atgcctttagatagtatttcaatcgatacgcaacccttatctaaaagtttcaataccgaa
acaaataatgaattagagacacagataattgtttcatcgctttcccaaggcatatctgct
cagaagggacctgtttttcattctactggccagacagaagaaataaaaacccaaataata
aattctcctgaacaaaatgctttgaatgcaacctttgaaactcccgttactctttctcgg
attaattttgaacccatattggaagttcctgagactagttcaccatctaagaatacgatg
tcaaaaccctcgaattcttcacctattccgaaggaaaaagatacatttaatatacacgag
agagaagtagagacaaacaatgttttttcaaacgatatacaaaattcttcaaatgcagct
accagagatgacattatcatagccggttcatctgatttcaacgaacaaaaggaaataacc
gatagaatatacttacaactttcaggaaagcaaatatctgattcaggaagtgatgaaaca
gaacgtatgtccccaaatgagcttgatacgaaaaaggaaagtacaatcatgagcgaggtt
gaactaacccaagaactgcctgaagttgaagagcagcaagatcttcaaacgtctccaaaa
aagctggtagtcgaggaagaaactttaatggagataaaaaaaagcaaggggaactcactt
cagcttcatgatgataataaagaatgcaattcagataaacaagatggcacagagtctttg
gatgtagctttgattgaacacgaaagcaaaggacagagctcagaacttcagaaaaacctc
atgcaattatttccaagtgagtcacaggagattattcagaaccgaagaacaataaagcga
cgtcaaaaagatacaatagagatcggtgaagaggaggagaacagaagcactaagacatca
ccgacaaaacacctcaaaagaaattcagatttggatgctgcttctatcaaaagggaaccg
tcttgcagcattaccatacaaacaggggagacaggttcgggcaaagactctaaagaacag
tcttacgtgtttcctgaaggtattagaacggcagataatagtttcttatcgaaagacgac
ataatttttggaaatgcggtatggtgtcagtatacgtggaattacaaattttatccgggt
attttattggaagttgacactaatcaagatggctgttggatttatttcgaaacaggaaga
tcgctaaccaaagatgaggacatctactacttagatattagaataggggatgctgttacc
tttgatggaaatgagtacgtagtcgttggtctagaatgtcgtagccatgatctcaacata
ataagatgtattcgaggatatgatacggttcatttgaaaaaaaaaaatgcaagcggattg
ttggggaaaaggacgttaattaaagcactaagctcgatcagtcttgacctaagcgagtgg
gctaaaagagcgaagatcatattagaagataatgagaaaaataaaggcgacgcgtatagg
tacttgagacatcccattaggggaaggaaatcaatgaccaatgttctgtctccgaagaaa
catactgatgacgaaaaggacataaatacgcatactgaagtgtacaataacgaaatagaa
tcgagctccgaaaagaaggaaattgttaaaaaggattctagagacgcattagctgaacat
gcaggagcgccaagcctgcttttttcttctggtgaaatcagaacagggaatgtatttgat
aaatgtatttttgttttgacaagcctattcgaaaatagagaggaacttcgacagaccatt
gaatcgcaaggcggcactgtaattgagtcaggattttccactttatttaacttcactcat
ccgctagctaaatctttagtcaataaaggtaatacagataatattcgagaattggccttg
aagctagcctggaaacctcattccctatttgcagactgcagatttgcttgcctaatcaca
aaacggcatttaagaagcttaaagtacttagaaactttggcgttggggtggcctacacta
cactggaaattcataagtgcatgcattgaaaagaaaagaatagtaccacatttaatatac
caatacctattaccttcgggtgaaagttttcggttatcgttagattctccatcaaaggga
ggaatcattaaatccaacaatattttttcattttatacacaattcttacgcggatctaat
ttaagagatcagatatgtggagtgaagaaaatgttaaatgactacattgttattgtttgg
ggtagatctgagttggacagttttgtcaaatttgcttttgcatgtttgagcgcaggtaga
atgcttacaattgatttacccaatattgatgtagatgatacagagccattgttaaatgcc
ttagattctttagtacccagaataggatcagaattatctaatcgaaagttaaagtttctc
atatatgctaacgaaaataatggtaaatctcagatgaagcttctcgaaagattgagaagt
caaatatcactgaaatttaagaaatttaattacatatttcacactgaatctaaagaatgg
ctaattcagacaataattaacgaggacactggttttcacgatgatattacggacaatgat
atatacaacactatttctgaggttagatga

DBGET integrated database retrieval system