KEGG   Saccharomyces cerevisiae (budding yeast): YDR285W
Entry
YDR285W           CDS       T00005                                 

Gene name
ZIP1
Definition
(RefSeq) Zip1p
  KO
K12768  synaptonemal complex protein ZIP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR285W (ZIP1)
SSDB
Motif
Pfam: AAA_13 TPR_MLP1_2 HrpB7 TACC_C DUF373
Other DBs
NCBI-GeneID: 851879
NCBI-ProteinID: NP_010571
SGD: S000002693
UniProt: P31111
LinkDB
Position
IV:1032436..1035063
AA seq 875 aa
MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPH
KTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFEI
TEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKAPLHTSINNSSTSSNDVL
LEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERI
ATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKG
KEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDKAHHLLQFNKF
EERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENLEQKMSSS
KDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYA
SLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEA
KNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKA
LVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELELEEQ
NRHLKNCLEKKETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQDNLESLEEVTKNL
QQKVQSQKRELEQKIKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLFPNNSAA
IHSPMKKCPKVDHISKSRINSSKETSKFNDEFDLSSSSNDDLELTNPSPIQIKPVRGKIK
KGSNCMKPPISSRKKLLLVEDEDQSLKISKKRRRK
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgtcaaacttttttagagatagttcaatgggattcaagcctcgaccaaacatcttcgct
aagctgagagtcagagatgtagattcagattcttccgctaatactgttgtcgagaattca
tccaactgtttagacgtgggttcttctatagagggagatgataccttcaaaaaaccccac
aaaacttctaccgaacaagaactgattacaagtatgagccttagtcagagaaaccatggt
tattctgatgatatggaaataggttcaccaaaaaaaacaacatcaacagaccaatacaac
agaattttaaaaaatgatgttgccgcaattgaaaatgatactgatgaagattttgaaatt
acagaagtaagagaagtgagtgaaggagtagcaaaagaaacgaaagaaagtcatggggat
cctaacgattctgagacaactctcaaggatagtaaaatgcatgaatatactatgacaaat
ggaaaggctcctttgcacacgtccatcaataattctagtacatcttcaaatgatgtcctg
ttagaagccttcacaaacactcaaagaatatgttcaaatttaaagcaagagctacaaaag
cagcaacaggataatgcaaagttgaaagttcgactacagtcgtatgcttccaattctgat
aagatcaatgaaaaagtcggaaaatataaatcttgtttagaaactcttcaagaaaggatt
gcaacgttgacgagccataagaataatcaagaaactaaattgaaagatttaagacaaaac
caccaactatatcagagaaggataagcggatttaagacaagtattgaaaacttgaacaaa
acaataaatgatttagggaagaacaaaaaggaggcggatgcagaattaatgaaaaaaggt
aaagagattgaatacctgaaaagagaactagatgattgttcaggtcagttgagcgaagaa
aaaatcaaaaacagttccttaatacaggaaatgggaaaaaatagagaagaaatgattaaa
tcaattgagaatttcttttcagaagataaagcacaccatttactgcaatttaacaaattc
gaagaaagagttcatgatttgtttgaaaaaaaattacaaaagcacttcgatgtggcaaaa
gatacccttaacgtaggcttgaggaacaccactgtagagttgagtagtaatacagagacc
atgctaaagcagcaatatgaagatatcaaagaaaatcttgaacaaaaaatgtcatccagt
aaggatgaaatggcaaaaacaataaatgagctgagtgtaacgcaaaaaggacttataatg
ggagtacaagaagaactattaacgtcatcagggaatattcaaactgctttggtaagtgaa
atgaataacacaaggcaagagcttcttgatgatgcgtctcaaacagccaaaaattacgcg
agtttggaaaacttggtgaaggcatataaggcagaaatagttcagtcgaatgagtatgaa
gaaaggataaaacatttggagagtgaaaggtcaactttgtcttcacaaaaaaatcagatt
attagctctcttggtactaaagaagcacaatatgaagatttggtcaaaaagttggaggcg
aagaatatcgaaatttcacaaatttctggcaaagaacaaagtttaactgaaaaaaatgaa
aacctttctaatgaactgaaaaaagtccaggatcaactagaaaaactcaacaatttgaac
atcacaacaaaatcaaattacgaaaataaaatatcttctcagaatgaaattgtgaaggct
ttagtttccgaaaacgacactctgaagcaaagaattcaacagctagtagaaatcaaagaa
aatgaacagaaggatcatacaaccaaactggaggctttccaaaagaacaatgagcagcta
caaaagctaaacgtcgaagtagtacaactgaaggctcatgaattggagcttgaagagcag
aataggcacttaaaaaattgtttagaaaaaaaggaaactggtgttgaagaatcactaagc
gatgtaaaaaccctaaaacagcaagtgatagttctgaaatcggagaagcaagatataaca
gctgaaaagttagaacttcaagataacctcgaaagtttggaagaagtcaccaaaaattta
cagcaaaaggtgcaatcgcaaaagagggaattagaacagaagattaaagagctagaagag
ataaaaaaccataaacggaacgagcctagtaaaaaaggtacacaaaattttactaaacca
tcagattcacccaaaaaaaatgctacgacgtccaacttatttcctaataactctgctgcc
attcactctcctatgaaaaagtgtcctaaggtggatcatataagtaagtcaagaattaat
tcatccaaagaaacatccaaatttaacgatgagttcgatctttcttcatcatcaaatgac
gacctagagttaaccaacccttccccaatccaaattaaaccagtgagaggaaaaatcaag
aagggttcaaattgcatgaaacctccaatttcttcaagaaaaaaattactactagtagaa
gacgaagaccagtcattaaaaataagcaagaaaaggagaaggaaatag

DBGET integrated database retrieval system