KEGG   Saccharomyces cerevisiae (budding yeast): YDR310C
Entry
YDR310C           CDS       T00005                                 

Gene name
SUM1
Definition
(RefSeq) Sum1p
  KO
K12779  suppressor of MAR1-1 protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR310C (SUM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YDR310C (SUM1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Other transcription factors
   Others
    YDR310C (SUM1)
SSDB
Other DBs
NCBI-GeneID: 851905
NCBI-ProteinID: NP_010596
SGD: S000002718
UniProt: P46676
LinkDB
Position
IV:complement(1081128..1084316)
AA seq 1062 aa
MSENTTAPSDNITNEQRLPSGPKDDVDTLALTSAQNQANSLRKLDTDANAKALPSITDIP
VSDDSDIKRQVGSGFGSNPLHIKDSEAFPHSSIEALKEGMDKVTKQCNDLKTALLSKDTS
LTDSVQDLFNSLKVLSHNQSVLENKLDDVMKNQVNTDILVNNLNERLNKLSTMLQNTSKV
NHSNLLIENSSNNTSSQHNTSSSRRGPGRPRKDASTSTMNKLVSNAASVNLKSASNQGAP
FSPVNITLPTAVVQTSKSKRYFVEPSTKQESLLLSAPSSSRDDADMSLTSVPQRTNNENG
KERPSTANSSSITPTPVTPNNLIQIKRKRGRPPKKRTVETMISNSTDTIDKSDASNRIKN
EIPINSLLPSSKFHQIPSSPSNPVSQPAPVRTSRSATQEIDIKSLELASLISTNGDPNAE
DSNTTDTVHNNVEGKVNVEENKTEKEKIITIKSSSENSGNNTTNNNNTDNVIKFSANSDI
NSDIRRLMVNDQFSLSYDASGNITVKLPPVSSPAAATAAAAAAVTSEMNRQQRELDKRRD
SREKMLVNMKYNDRDKAKSFMESNKKLLKAMKEEERRKRMTSIIHDNHLNLNLNEISTRS
KIKSAEKPTTKGSSMSPKPRSASISGISDHQQEGYQPLEQEKLVDIDNEGSNANSDSLKM
GLTISAADTVHKVGIQSMLNSGEEAITKENAEYERKTPGDEETTTFVPLENSQPSDTIRK
RTAGDDGALDQTENTSISPKKRRTEDHTKGEEDEGERGVGNSGTLATVENVSGDISADLS
KGTSSIHNDTESANDSSNGNGNLGLGTESRNTLLTATPIELICREGFFYRRDIPDVPITT
GAYLEFKFKAKEEELINSSINEEDYAAKSKHEKMNAHFFKPDIQEETELAFEILSKTTLT
EKYVNSLEYFLMEFRWENKLVGLGLKLRESKRTWQRRKALFALFEFWRDQSRDKRRFHNY
TILHAVKEMENYRIFINRSVSWFYNHITLLKMILYDLCDNVTTQWREWMFPHNETLPALG
QDGINEDNLNETIDNMLIFDFLDDGSENNQVKYSRIIPPDIR
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgagaacaccacagccccttctgataacataaccaatgaacagagacttccgtct
ggacccaaagatgacgtagatacgttagcacttaccagtgctcaaaatcaagctaatagt
ttgaggaagctagatacagatgcgaacgctaaagctttgccatccatcacagacatacca
gtcagtgatgattctgatataaaacgacaagttggctctggttttggttcaaatccgctt
catataaaagattccgaggcctttccacattcatctattgaagccctaaaagagggtatg
gacaaagtcacaaaacaatgcaacgatttgaagacggctttgctttccaaagacacttcc
ctcactgattctgtgcaggatttgtttaactcattaaaagttttatcacacaaccaatca
gttttggaaaataagctggatgatgtcatgaagaatcaagtaaatactgacatattggtc
aataatttgaatgaacgattgaacaaattatcgacaatgttgcaaaatacttcgaaagta
aatcactctaaccttctcatagaaaattcatccaacaataccagttcacagcataatacc
tcttcttctcgaaggggacctggcaggccaagaaaagatgcctcgacctccacaatgaat
aagttagtgtcaaacgcagcctcggtcaatctcaaaagtgcatccaatcagggtgctcct
ttctcaccagtaaatattactttaccgactgccgtagtacaaacgtctaaatccaaaagg
tattttgtggaaccatcaacgaaacaagagtcgcttttattatctgccccttcatcatca
agagatgatgctgatatgtccttgacttccgtaccgcaaagaacgaacaatgaaaatggt
aaagagcgaccatccactgctaattctagctccatcacaccaacacctgttacgccgaac
aacttaattcaaatcaaaagaaaaagaggcaggcccccaaaaaagagaacagtggaaaca
atgatatccaattccacggatacgatagataagtcagatgcatctaatcggattaaaaac
gagattccaataaattccttgcttccatcttccaaatttcatcaaataccatcatctcca
tccaatcctgtgtcacaaccggctccggttcggacttcaaggtcagccacacaagaaata
gacattaaaagtttagaactggcctctctaatttcaactaatggtgatccaaacgcagag
gattcgaatactactgatactgttcataataacgtggaaggaaaggtaaatgttgaagaa
aataaaaccgagaaggagaaaataataaccatcaaatcatccagcgaaaatagtggtaat
aatacgaccaataataataatactgacaacgtcattaaattttcagctaattcagatatc
aatagtgatattcgccgattaatggttaacgatcagttttcattaagttatgacgccagc
ggtaatattacggtcaaattaccacccgtttcctctccagcagcagcaacagctgccgct
gctgcggcggttacgtcagagatgaatagacaacaaagagaattagataaaagacgtgat
tcaagggagaaaatgcttgttaatatgaaatataacgatcgcgataaagcaaagtcattt
atggagtctaataagaaactcttaaaagcaatgaaagaagaagagaggaggaaaagaatg
acttcgataatacatgataatcacttgaacttaaatttgaatgagatctccacccgttca
aagataaaaagtgcagaaaaaccaacaactaaaggttcttcaatgtcgccaaaaccaaga
tcggcctccatcagcggcatttcagaccaccaacaggaaggatatcaaccattagagcaa
gaaaaactcgtcgatattgacaatgagggctcaaacgcaaacagcgactctctcaagatg
ggtctaaccatatccgctgccgatacggttcacaaagttggaatacagtccatgctaaat
tctggggaagaggcaattaccaaggagaatgcagaatatgaaagaaagaccccgggagat
gaagaaactaccacgttcgttccattagaaaactcacaaccttcggacacgataaggaaa
agaacagcaggcgatgacggtgcattggatcaaacagagaatacgagcatatcaccaaag
aagagacgcacagaagatcatacaaaaggtgaagaagatgagggagaaaggggtgttggt
aatagcggaacgctggccaccgtggagaatgtctcaggagacatctccgcagatttatcc
aaaggtacttcatctatccataacgatactgagtctgctaacgatagtagcaatggcaac
ggaaacctcggtttgggtacagagtcacgcaatacattgttaacggcaactcccattgaa
ttaatctgccgggaaggcttcttctaccggagagatattccggacgttcccattaccaca
ggagcgtacctggaatttaaattcaaggcgaaagaagaggaattgatcaactctagcatc
aatgaggaggattatgctgctaaatcaaagcatgaaaaaatgaatgcgcatttcttcaag
cctgatattcaagaagagacggaacttgcctttgaaattttgagcaagacaacgctgaca
gagaaatacgttaacagtttggagtacttcttgatggaattcaggtgggagaataaacta
gttggtctaggcttaaaacttcgggaatccaaaagaacctggcaaaggagaaaggcgtta
tttgcccttttcgaattttggagagaccaatcaagagacaaaagaagattccacaactac
accatcctgcatgcggtgaaagagatggaaaactacagaatatttattaatcgatccgtt
tcatggttctacaaccatattaccctgctaaaaatgatcctctacgacctctgcgacaat
gtgaccactcaatggagagagtggatgtttccccataacgaaacactgccggcattgggt
caggacggcattaacgaagacaatctgaatgaaaccatcgacaacatgttaatttttgac
ttccttgatgacggttcagaaaacaaccaggtcaaatattccagaatcataccgccagat
atccgttaa

DBGET integrated database retrieval system