KEGG   Saccharomyces cerevisiae (budding yeast): YDR436W
Entry
YDR436W           CDS       T00005                                 

Gene name
PPZ2
Definition
(RefSeq) salt homeostasis regulator
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YDR436W (PPZ2)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR436W (PPZ2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YDR436W (PPZ2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YDR436W (PPZ2)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR436W (PPZ2)
   03041 Spliceosome [BR:sce03041]
    YDR436W (PPZ2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YDR436W (PPZ2)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YDR436W (PPZ2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YDR436W (PPZ2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YDR436W (PPZ2)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YDR436W (PPZ2)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 852046
NCBI-ProteinID: NP_010724
SGD: S000002844
UniProt: P33329
LinkDB
Position
IV:1334821..1336953
AA seq 710 aa
MGNSGSKQHTKHNSKKDDHDGDRKKTLDLPPLTKSDTTHSLKSSRSLRSLRSKRSEASLA
SNVQAQTQPLSRRSSTLGNGNRNHRRSNNAPITPPNNHYLTSHPSSSRRLSSSSRRSSMG
NNNNSELPPSMIQMEPKSPILKNSTSMHSTSSFNSYENALTDDDDDRGDDGGESPSMAKV
TRINTSSSADRGSKRTPLRRHNSLQPEKGVTGFSSTSSKLRRRSDNTLPASYPLNAEAGG
NGSDYFSNRSNSHASSRKSSFGSTGNTAYSTPLHSPALRKMSSRDNDDSGDNVNGRGTSP
IPNLNIDKPSPSASSASKREYLSAYPTLAHRDSSSSLSPRGKGQRSSSSSSSSQRIYVSP
PSPTGDFVHGSCADGDNGSRTNTMVEMKRKKPVRPVDIDEIIQRLLDAGYAAKRTKNVCL
KNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFL
GDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWK
TFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPT
DSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAP
NYCGEFDNWGAVMTVSEGLLCSFELLDPLDSTALKQVMKKGRQERKLANR
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgggtaattccggttcgaaacaacataccaagcacaatagcaagaaggatgaccacgac
ggtgacaggaaaaagacactagatctcccaccactgacaaaatcggatactacacattcg
ctgaaatcgtcaaggtcgctgaggtcgctgcggtcgaaacgctcagaggcgtcgttggca
tctaatgttcaagctcaaacgcaacccctctcccgcagatcgtccactctgggaaacggc
aatcgcaaccataggcgatcaaacaacgccccaatcactcctcctaataaccactaccta
acctcacatcccagttcgtcaagaagactctcttcctcttcgagaaggtcgagcatgggg
aataataacaattcagaattgcccccgtcaatgatccagatggagcccaaatcacccatc
ttgaaaaatagtacaagcatgcattccactagctctttcaactcttacgaaaatgcgttg
actgatgatgacgacgataggggggatgatggcggcgagagcccctcaatggccaaagtt
actcgcatcaacactagttcttccgcagatagaggctccaagcgtactcctttaagacgt
cataattcattacaaccggaaaaaggtgtaacaggattttcctcgacttcatcgaaatta
cgcagaagatcagacaatactctgccagcaagttatcctttaaatgcagaagcaggaggg
aatggcagcgactatttctcaaacagatcaaactcgcatgcatcatccaggaagtcgtca
tttggctccactgggaatacagcttatagcacaccactgcattcacctgcgttaagaaaa
atgagctcgagggacaacgacgatagcggagacaacgtcaacggtagaggcacctcacct
atccctaatctaaacatagacaagccttcgccgtcagcgtcgtcagcgtcaaaaagagaa
tatttaagtgcatatccaacactagctcacagagattcatcatcttcacttagtccgcgg
ggcaaaggacaacggtcttcatcgtcttccagttccagtcaaagaatatatgtttcccca
ccatctcccacaggtgatttcgtacacgggagttgtgcagacggtgataatggatctagg
actaatactatggtcgaaatgaaaaggaaaaaaccagttcgtccagtggacatagatgaa
attatccagagattactagatgccggctatgccgcaaagaggaccaagaatgtttgctta
aagaattccgagattattcaaatttgccataaggctcgtgaattattccttgcccaacct
gctctcttagaattatctccctcggtaaaaatagtgggtgatgttcacggccaatatgca
gatcttttgagactttttaccaaatgcggtttcccccccatggcaaattacttattttta
ggcgattacgtagatcgcggtaagcagtccctggagaccattttactattactatgctat
aagattaaatatcctgaaaatttcttcctcttaagaggcaatcatgaatgtgccaatgtt
acaagagtctacgggttttatgatgaatgtaaacgacgttgtaatatcaagatttggaaa
acctttgttgacacgttcaacacgctaccgttagcagccatcgtcacaggaaaaatattt
tgtgttcatggtggactatcacctgttctaaattccatggacgaaattaggcacgttagt
aggcccaccgatgtacccgacttcggcttaattaatgaccttttatggtcggatcctaca
gattcatcgaatgaatgggaggataatgagcgtggagttagtttttgttacaataaagtg
gctattaataaatttttaaacaaattcggattcgatttagtgtgtagagcacatatggtg
gtggaagatggttatgaattctttaatgacagaagcttagttacagtgttttcggctccc
aactattgtggtgaattcgataactggggtgctgtcatgaccgttagtgaaggcctactc
tgttcttttgagttgttggacccactggacagtaccgctttgaaacaagtgatgaaaaaa
ggcaggcaagaacgtaaattagccaatcgctga

KEGG   Saccharomyces cerevisiae (budding yeast): YER133W
Entry
YER133W           CDS       T00005                                 

Gene name
GLC7, CID1, DIS2
Definition
(RefSeq) type 1 serine/threonine-protein phosphatase catalytic subunit GLC7
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YER133W (GLC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YER133W (GLC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YER133W (GLC7)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YER133W (GLC7)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YER133W (GLC7)
   03041 Spliceosome [BR:sce03041]
    YER133W (GLC7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YER133W (GLC7)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YER133W (GLC7)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YER133W (GLC7)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YER133W (GLC7)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YER133W (GLC7)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 856870
NCBI-ProteinID: NP_011059
SGD: S000000935
UniProt: P32598
LinkDB
Position
V:join(432495..432671,433197..433958)
AA seq 312 aa
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQAGGRKKK
NT seq 939 nt   +upstreamnt  +downstreamnt
atggactcacaaccagttgacgttgataatatcatcgatagattattggaagtaagagga
tctaaacctggtcaacaagttgatctagaagaaaatgaaatcagatacttatgttcgaaa
gccagatctatattcataaagcaacccattttactagagttagaagccccaattaaaata
tgtggtgacattcatgggcaatactatgatttactacgtctatttgagtacggtggattc
ccgccagaatctaattatctatttttgggtgattatgtcgaccgtggtaaacaatcctta
gagactatttgtctattactggcttacaaaattaagtatccagaaaactttttcatttta
agagggaaccatgaatgtgcttccattaatagaatttacgggttttatgatgaatgtaag
agacgttataatatcaaactttggaaaactttcacggattgtttcaattgtttaccaatt
gctgcaattattgatgagaaaatcttctgtatgcatggtggtctctcaccagatttgaat
agtatggaacagatcagaagggtgatgaggccaacagatattcccgacgttggcttatta
tgtgacttattgtggtcagatccagataaagatatcgtaggttggagtgaaaatgataga
ggtgtttctttcacttttggtcctgatgtagtgaacagatttttacagaaacaagatatg
gagttgatttgcagggcccatcaagttgtggaagatggttatgaattctttagtaaaaga
caattggtgacacttttcagtgctccgaattattgtggtgaatttgataacgctggtgca
atgatgagtgttgatgaaagtttattatgttcttttcaaattttaaagccagcccaaaaa
agtctaccaaggcaagctgggggtagaaagaaaaaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YML016C
Entry
YML016C           CDS       T00005                                 

Gene name
PPZ1
Definition
(RefSeq) salt homeostasis regulator
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YML016C (PPZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YML016C (PPZ1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YML016C (PPZ1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YML016C (PPZ1)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML016C (PPZ1)
   03041 Spliceosome [BR:sce03041]
    YML016C (PPZ1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YML016C (PPZ1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YML016C (PPZ1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YML016C (PPZ1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YML016C (PPZ1)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YML016C (PPZ1)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 854992
NCBI-ProteinID: NP_013696
SGD: S000004478
UniProt: P26570
LinkDB
Position
XIII:complement(239458..241536)
AA seq 692 aa
MGNSSSKSSKKDSHSNSSSRNPRPQVSRTETSHSVKSAKSNKSSRSRRSLPSSSTTNTNS
NVPDPSTPSKPNLEVNHQRHSSHTNRYHFPSSSHSHSNSQNELLTTPSSSSTKRPSTSRR
SSYNTKAAADLPPSMIQMEPKSPILKTNNSSTHVSKHKSSYSSTYYENALTDDDNDDKDN
DISHTKRFSRSSNSRPSSIRSGSVSRRKSDVTHEEPNNGSYSSNNQENYLVQALTRSNSH
ASSLHSRKSSFGSDGNTAYSTPLNSPGLSKLTDHSGEYFTSNSTSSLNHHSSRDIYPSKH
ISNDDDIENSSQLSNIHASMENVNDKNNNITDSKKDPNEEFNDIMQSSGNKNAPKKFKKP
IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDV
HGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNH
ECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDE
IRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVC
RAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDPLDSAALK
QVMKKGRQERKLANQQQQMMETSITNDNESQQ
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgggtaattcaagttcaaaatcttcgaaaaaggattcacattcgaattcctcctcgaga
aatcctcgtcctcaagtgtcgagaaccgagacttcccattctgtgaagtctgcaaaatca
aataaatcttcaagatcaaggcgatctcttccttcttcgtccactacgaatactaattca
aacgtccctgatccctccactccatcaaagcccaatcttgaggttaatcaccaacgacat
agctctcacacgaatcgttaccatttcccatctagctcacactcgcattcaaattctcaa
aacgaattgttaactactccttcatcatcctctactaagaggccttctacttctagaaga
tcaagttataatactaaggctgctgctgatttaccaccttcaatgatccaaatggaaccc
aagtcacccattttaaaaacaaacaatagtagcacacacgtatccaagcataaatcttca
tactcatctacctattatgagaacgccttaaccgatgatgacaatgatgataaagacaac
gacatctcgcacactaaaaggttttctagatcttcgaattctcgtccgtccagtataaga
agcggatcagtgtcaagaaggaaatcagatgtgacccatgaagagcctaacaatggatca
tactcctctaacaatcaggagaattatctcgttcaggcattaacccggtcaaattctcat
gcatcttcgctacacagtaggaaatcttcgtttggatcagatggtaataccgcatacagc
accccattaaactctccaggcttgtccaagctaacagatcactctggtgaatactttacc
tctaattcaacctcctcattgaatcaccattcaagtcgcgatatttacccgagcaaacac
atcagcaatgatgatgacattgaaaattcatctcaattgagtaatatccatgcatcaatg
gaaaatgttaatgataaaaataataatataacagatagcaaaaaagatccgaatgaggaa
tttaatgatataatgcaatcttccggaaacaaaaacgctccaaaaaaattcaaaaagcct
atcgatattgatgaaactatccaaaaattactggatgcgggctacgctgctaagagaaca
aaaaatgtttgtttgaagaacaatgaaattttacagatttgcatcaaggctcgtgaaatc
tttctttctcaaccttccttattagaattatcacctcctgtaaaaattgtaggcgacgtt
catggccaatatggggatctcttaaggctttttaccaaatgtgggttcccaccatcctcg
aactatttattcctaggtgattatgtggaccgtggtaaacagtcactggagactatttta
ctattgttttgttacaaaataaaataccctgaaaatttctttttattgagaggcaaccat
gaatgtgctaacgtcacaagggtttatggattttatgatgaatgtaaacgtcgttgtaac
atcaagatctggaagacattcatcgatacttttaatacattaccattagctgctatcgta
gccggaaagattttttgtgttcatggtggattgtcgccagttttaaattctatggatgaa
atcagacatgtagttaggcctactgatgtaccagattttggcttaattaatgatcttttg
tggtccgatcccacagattcacccaacgaatgggaggataacgaacgtggtgtaagttac
tgttataataaggtggcaattaacaaattcttgaacaagtttgggtttgatttggtttgt
agagctcacatggttgtggaagacggttatgaatttttcaatgatagaagtctcgttacg
gtgttttccgcgccaaattattgtggtgaatttgataattggggggctgtaatgagcgtc
agcgaaggtttattgtgctcttttgaattgttagatccactagatagtgcagctttgaag
caagttatgaagaaaggtagacaggaaagaaaactggctaatcaacaacagcaaatgatg
gaaacaagcatcacaaatgataacgaatctcaacagtaa

KEGG   Saccharomyces cerevisiae (budding yeast): YPL179W
Entry
YPL179W           CDS       T00005                                 

Gene name
PPQ1, SAL6
Definition
(RefSeq) protein-serine/threonine phosphatase
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YPL179W (PPQ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YPL179W (PPQ1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YPL179W (PPQ1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YPL179W (PPQ1)
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPL179W (PPQ1)
   03041 Spliceosome [BR:sce03041]
    YPL179W (PPQ1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YPL179W (PPQ1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YPL179W (PPQ1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YPL179W (PPQ1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     YPL179W (PPQ1)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YPL179W (PPQ1)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 855923
NCBI-ProteinID: NP_015146
SGD: S000006100
UniProt: P32945
LinkDB
Position
XVI:208157..209806
AA seq 549 aa
MRRSPSRSNNNFAVPNCSTNSNSSQQQLTTPSDDLNSNEPNDPDDSRSLPTIKKFNNKHS
INNYNTLASAGKNNNNKRASNDNLLIPGENAHKQKIYTKDENLKSLYLDIDVSVAKALSS
SATAPKLINTARTSSTTTATTSNNILTSPSYRESNYSSPSSYSFSSYYSSATSASSSTSS
FLKSSGLSSRVKSPSSSVKAGSFGAPSSPTSGIPNPKSSKKPIFLRRYSHDTSSNEGLDI
DVAIEKLLQVGESREITKTSKKKNFPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVG
DVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRG
NHESANVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPDLHDM
KQIEKVARPTDIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDL
ILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSVTTGMMCSFELLKPRALKN
KKKLYKTKV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgagaagaagcccgtccagatcaaataataactttgcagtaccgaattgctcaactaat
tcaaactctagtcagcaacaattaactacaccttcagatgatctcaacagtaacgaacct
aatgacccagatgatagtaggtctctacctactatcaagaaattcaataataaacattct
ataaacaattacaacactttagcatcggccgggaaaaacaacaacaataaacgagctagc
aatgataatttgctcattcctggtgagaatgcccataaacagaaaatatacactaaggat
gaaaacttgaagagcttgtacctagatatcgatgtttctgtcgctaaagccctatcctca
tcagcaactgctccgaagctgatcaataccgcaagaacttcctctactaccactgccact
acctcaaataatatcctgacatcaccctcttatcgtgaatcaaattattcttctccatcc
tcatattctttttcctcctactactcatccgctacgtctgcttcctcatcaacctcatca
tttttaaaatcttcagggttatcgtccagagttaagtctccttcatcttcggttaaggca
ggttcttttggtgcgccttcgtccccaacatctgggatacctaatcctaaaagtagcaag
aagcctatatttttgagacggtattctcatgatacctcttcaaatgaaggtcttgatatc
gatgttgcgatcgaaaaattactacaagtgggtgagtcaagagaaattacaaaaacgtcc
aaaaaaaagaactttccattccattcttgggaaattcaactcatttgctatcatgcaaga
gaaatttttttgaatcaacctactcttttgagattacaagcgcctatcaaagttgtcggt
gatgttcatggacaatttaatgatttattgagaattttgaagttgtctggtgtgccatct
gatactaattatctgttcttgggtgattatgtggaccgtggtaagaactcattggaaaca
atactattgttattatgttacaaaataaagtacaaagacaacttttttatgttaaggggt
aatcacgaatctgctaatgtcacaaagatgtacggtttctatgatgaatgcaaaaggcga
ttgagctcgaaagtatggaaaatgttcgttgacgtatttaatactttgccattagcagca
attattcaagataagatcttttgcgttcatggaggtatatcgcccgatttacatgacatg
aagcaaatcgaaaaagtcgcaagaccaacggatattcctgaaagcgggctggttacagac
ttactgtggagtgacccagaccctcaagtaactgattggtcagaaaatgatcgtggtgtt
tcatacacattttctaagaggaacgttcttgatttttgtgctaagtttaaattcgattta
atacttaggggacatatggtcgtagaagatggttatgaattctttgccaggaaaaagttt
gtcacaatcttttcagcaccaaattattgtggagaatttcataattggggggcagtaatg
agcgttacaacgggtatgatgtgtagctttgaactgttaaagccgcgtgcattgaaaaat
aaaaagaagttatacaaaaccaaagtgtag

DBGET integrated database retrieval system