KEGG   Saccharomyces cerevisiae (budding yeast): YDR439W
Entry
YDR439W           CDS       T00005                                 

Gene name
LRS4
Definition
(RefSeq) Lrs4p
  KO
K12775  monopolin complex subunit LRS4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR439W (LRS4)
SSDB
Motif
Pfam: LRS4
Other DBs
NCBI-GeneID: 852049
NCBI-ProteinID: NP_010727
SGD: S000002847
UniProt: Q04087
LinkDB
Structure
PDB: 
3N7N

Position
IV:1339676..1340719
AA seq 347 aa
MTTLLQLLSNYYKAKLDSERIYNEYVQSQYEFASLDKLNNNKGDPKKVVDETLFLQRQIA
QLNKQLQLSFQENEKLLSVQKNQKALYQSKLSSKDAFIDDLKLKLKVEQISVDKHNKERT
PSTGRDEQQRNSKAAHTSKPTIHLLSPIVNRDKPNNQTNDRGGNDPDSPTSQRRSRGLRS
LLSSGKNTIFDSISKNLDDEINENAHIRNDTTSSKIAGKSPSRLSALQKSPELRKERNNM
ILKEHILRSKDDQNITSSRKLDNIELSSIGDSTAMTSRSSTVNANDILGNEENDGITKLK
RVNKLTSSPVKRDCSTNKKRKLTKQRIATLPNSDEELSNNLNVDEFV
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgacaactttattacagctcttgtcaaattattataaggctaaattagattcagaacga
atatacaatgaatatgttcagtcgcagtatgagtttgcatctttagacaagttgaacaac
aataaaggtgacccaaagaaagtagttgatgagacattatttttgcagaggcaaattgcc
cagctgaataaacagttacaactttcatttcaagagaatgaaaaactattaagcgtacag
aagaatcaaaaagctctttatcaaagtaagttatccagcaaggatgcattcattgatgat
ttgaaactcaaactgaaagtcgagcagatatctgtagacaaacataataaggaacggaca
ccttcaacaggccgtgatgaacaacagcgtaattcaaaagcggcacatacatcaaagccc
acaattcatcttctttcgccaattgtaaatcgtgataagcctaataatcaaacgaacgac
aggggtggcaacgatcctgactcgcctacatcacaaagaagatcaagaggactgagatct
ttattgagttcaggtaaaaatacaatatttgattcaatatccaaaaatctcgacgatgag
ataaatgaaaatgcgcatatcagaaatgataccacatcttccaagatagctggcaaatcg
ccatcaagattatctgcgctgcaaaaatctccagaactgcgtaaagaaaggaacaatatg
atattaaaggaacacatactgcgttcaaaagatgaccaaaatatcacgtcatctagaaaa
ctggataatatcgagctatctagtattggtgactctactgcaatgacatcaaggagttct
accgttaatgcaaatgacatcttgggaaatgaagagaacgacgggattacaaagctgaaa
agagttaacaagttaaccagctctccagttaaaagggattgcagtacaaacaagaaaaga
aaactcacaaagcagcgaattgccacgttacccaactcagatgaagaattgagtaataat
ttaaatgttgacgagtttgtatga

DBGET integrated database retrieval system