KEGG   Saccharomyces cerevisiae (budding yeast): YDR523C
Entry
YDR523C           CDS       T00005                                 

Gene name
SPS1
Definition
(RefSeq) putative serine/threonine protein kinase SPS1
  KO
K12771  sporulation-specific protein 1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YDR523C (SPS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YDR523C (SPS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YDR523C (SPS1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  STE20 family
   YDR523C (SPS1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal DUF5442 DUF445
Other DBs
NCBI-GeneID: 852135
NCBI-ProteinID: NP_010811
SGD: S000002931
UniProt: P08458
LinkDB
Position
IV:complement(1485566..1487038)
AA seq 490 aa
MESKEISIRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIEL
LAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSF
IIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTPY
WMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP
FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKNITITNLKSDVDLIKQKKVQERYTKVP
KYPLQNRLYKNSNTVRGKEFWNFESTRLSTTQISKEELSPITQDSPTSSLNMESPYLLHG
QTVTPITNPSSSSFRKCTQPVFELDSGMDIDSGCPNAQAETEIVPLSNHNKKHKKNDIQA
LKIEKFDYLKNIVSHILNRMYDRARDDETRKYVNEMLKQFIKTEANVPGFNEVFIEEISL
RIEAIKKGFV
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaaagcaaagaaatatcaattaggtcaagaacccctccatcgaagctatattccatc
caatcatgtattggcagaggtaactttggtgatgtgtataaagcagtggatagagttacg
caagaaattgtggcaattaaggtggtcaacctggagcattccgacgaagacattgaactg
ttagcacaggaaattttttttctggcggaattgaaatctcctcttattacaaactatatt
gcaacaatgttagaagatgtctctatgtggattgtcatggaatattgcggcggtggatca
tgttcagatttactgaagcgaagttacgtcaacggtttgcctgaagaaaaagtttccttc
attattcatgaagtcaccttgggtttgaaatacctgcatgagcaaaggaaaattcatcgt
gatatcaaagcagctaatattttactaaatgaagaaggtatggttaagttgggtgatttc
ggagtaagtggccacattcgttccactttgaaaagggacacttttgtaggaacgccgtat
tggatggctccggaagttgtttgctgcgaagttgatgggtataatgagaaagcagatata
tggtccttgggtatcaccacctatgagttactcaagggcttacccccattatctaaatat
gatcctatgaaagttatgactaacttaccaaaaaggaagcctccaaaattacaaggtccc
ttttcggatgcagcaaaggatttcgtagctggttgtcttgttaaaacacctgctgatcgg
ccatcggcatataacttgttatcatttgaatttgttaagaatatcaccataacgaacttg
aaaagtgatgttgatctaattaaacagaaaaaggttcaggagagatatacaaaagttccc
aaataccctcttcaaaatcgcttgtataaaaacagcaacacagtgaggggaaaggaattt
tggaattttgaatcgacaagactaagcacaacacaaatttccaaagaggaattatctccc
attacacaagactctccaacatcatctttaaatatggaaagtccttatttacttcatggg
caaactgtaacgccgataaccaacccaagttcttcatcatttagaaaatgtacgcaacca
gttttcgagcttgattcaggaatggatatagattcaggctgcccaaatgctcaagcagag
accgaaatagttcctctctctaatcataataagaagcataaaaagaacgatattcaggcg
ttgaagatagaaaagtttgactacttgaaaaacattgtatctcatattctcaacagaatg
tatgatcgtgcgcgcgacgatgaaacaagaaaatacgtaaatgaaatgttaaagcaattc
attaaaactgaggcaaacgttcctggatttaatgaggtttttatagaagagatctcacta
agaattgaagcaataaagaaaggattcgtttaa

DBGET integrated database retrieval system