KEGG   Saccharomyces cerevisiae (budding yeast): YER015W
Entry
YER015W           CDS       T00005                                 
Symbol
FAA2, FAM1
Name
(RefSeq) medium-chain fatty acid-CoA ligase FAA2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce00071  Fatty acid degradation
sce01100  Metabolic pathways
sce01212  Fatty acid metabolism
sce04146  Peroxisome
Module
sce_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YER015W (FAA2)
   00071 Fatty acid degradation
    YER015W (FAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YER015W (FAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YER015W (FAA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YER015W (FAA2)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     YER015W (FAA2)
Lipid biosynthesis proteins [BR:sce01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   YER015W (FAA2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   YER015W (FAA2)
  Exosomal proteins of breast cancer cells
   YER015W (FAA2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 856734
NCBI-ProteinID: NP_010931
SGD: S000000817
UniProt: P39518
LinkDB
Position
V:184541..186775
AA seq 744 aa
MAAPDYALTDLIESDPRFESLKTRLAGYTKGSDEYIEELYSQLPLTSYPRYKTFLKKQAV
AISNPDNEAGFSSIYRSSLSSENLVSCVDKNLRTAYDHFMFSARRWPQRDCLGSRPIDKA
TGTWEETFRFESYSTVSKRCHNIGSGILSLVNTKRKRPLEANDFVVAILSHNNPEWILTD
LACQAYSLTNTALYETLGPNTSEYILNLTEAPILIFAKSNMYHVLKMVPDMKFVNTLVCM
DELTHDELRMLNESLLPVKCNSLNEKITFFSLEQVEQVGCFNKIPAIPPTPDSLYTISFT
SGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMVIAYDL
AIGFGIGFLHKPDPTVLVEDLKILKPYAVALVPRILTRFEAGIKNALDKSTVQRNVANTI
LDSKSARFTARGGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLR
SALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYHADKDLKG
ELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISVIDRVKNFFKLAHGE
YIAPEKIENIYLSSCPYITQIFVFGDPLKTFLVGIVGVDVDAAQPILAAKHPEVKTWTKE
VLVENLNRNKKLRKEFLNKINKCTDGLQGFEKLHNIKVGLEPLTLEDDVVTPTFKIKRAK
ASKFFKDTLDQLYAEGSLVKTEKL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggccgctccagattatgcacttaccgatttaattgaatcggatcctcgtttcgaaagt
ttgaagacaagattagccggttacaccaaaggctctgatgaatatattgaagagctatac
tctcaattaccactgaccagctatcccaggtacaaaacatttttaaagaaacaggcggtt
gccatttcgaatccggataatgaagctggttttagctcgatttataggagttctctttct
tctgaaaatctagtgagctgtgtggataaaaacttaagaactgcatacgatcacttcatg
ttttctgcaaggagatggcctcaacgtgactgtttaggttcaaggccaattgataaagcc
acaggcacctgggaggaaacattccgtttcgagtcgtactccacggtatctaaaagatgt
cataatatcggaagtggtatattgtctttggtaaacacgaaaaggaaacgtcctttggaa
gccaatgattttgttgttgctatcttatcacacaacaaccctgaatggatcctaacagat
ttggcctgtcaggcctattctctaactaacacggctttgtacgaaacattaggtccaaac
acctccgagtacatattgaatttaaccgaggcccccattctgatttttgcaaaatcaaat
atgtatcatgtattgaagatggtgcctgatatgaaatttgttaatactttggtttgtatg
gatgaattaactcatgacgagctccgtatgctaaatgaatcgttgctacccgttaagtgc
aactctctcaatgaaaaaatcacatttttttcattggagcaggtagaacaagttggttgc
tttaacaaaattcctgcaattccacctaccccagattccttgtatactatttcgtttact
tctggtactacaggtttacctaaaggtgtggaaatgtctcacagaaacattgcgtctggg
atagcatttgctttttctaccttcagaataccgccagataaaagaaaccaacagttatat
gatatgtgttttttgccattggctcatatttttgaaagaatggttattgcgtatgatcta
gccatcgggtttggaataggcttcttacataaaccagacccaactgtattggtagaggat
ttgaagattttgaaaccttacgcggttgccctggttcctagaatattaacacggtttgaa
gccggtataaaaaacgctttggataaatcgactgtccagaggaacgtagcaaatactata
ttggattctaaatcggccagatttaccgcaagaggtggtccagataaatcgattatgaat
tttctagtttatcatcgcgtattgattgataaaatcagagactctttaggtttgtccaat
aactcgtttataattaccggatcagctcccatatctaaagataccttactatttttaaga
agtgccttggatattggtataagacagggctacggcttaactgaaacttttgctggtgtc
tgtttaagcgaaccgtttgaaaaagatgtcggatcttgtggtgccataggtatttctgca
gaatgtagattgaagtctgttccagaaatgggttaccatgccgacaaggatttaaaaggt
gaactgcaaattcgtggcccacaggtttttgaaagatattttaaaaatccgaatgaaact
tcaaaagccgttgaccaagatggttggttttccacgggagatgttgcatttatcgatgga
aaaggtcgcatcagcgtcattgatcgagtcaagaactttttcaagctagcacatggtgaa
tatattgctccagagaaaatcgaaaatatttatttatcatcatgcccctatatcacgcaa
atatttgtctttggagatcctttaaagacatttttagttggcatcgttggtgttgatgtt
gatgcagcgcaaccgattttagctgcaaagcacccagaggtgaaaacgtggactaaggaa
gtgctagtagaaaacttaaatcgtaataaaaagctaaggaaggaatttttaaacaaaatt
aataaatgcaccgatgggctacaaggattcgaaaaattgcataacatcaaagtcggactt
gagcctttaactctcgaggatgatgttgtgacgccaacttttaaaataaagcgtgccaaa
gcatcaaaattcttcaaagatacattagaccaactatacgccgaaggttcactagtcaag
acagaaaagctttag

DBGET integrated database retrieval system