KEGG   Saccharomyces cerevisiae (budding yeast): YER098WHelp
Entry
YER098W           CDS       T00005                                 

Gene name
UBP9
Definition
(RefSeq) putative ubiquitin-specific protease UBP9
  KO
K11872  ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YER098W (UBP9)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YER098W (UBP9)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YER098W (UBP9)
Peptidases and inhibitors [BR:sce01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   YER098W (UBP9)
Ubiquitin system [BR:sce04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    YER098W (UBP9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 856835
NCBI-ProteinID: NP_011024
SGD: S000000900
UniProt: P39967
LinkDB All DBs
Position
V:355466..357730
Genome map
AA seq 754 aa AA seqDB search
MIKRWLSVNRKKSHPEKNTQGNDEINRKATSLKKTKGSGDPSIAKSPSAKSSTSSIPSNL
ASHERRSKFSSQTDNLAGNKHYHEHYHNMASTSDEREYDSSTTYEDRAFDTESSILFTTI
TDLMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRYPERVAAVNRIRKSDL
KGSKIRVFTNESFETSTNSGNSNTGYQSNDNEDAHNHHHLQQSDQDNSSSSTQEKQNNFE
RKRNSFMGFGKDKSNYKDSAKKDDNNEMERPQPVHTVVMASDTLTEKLHEGCKKIIVGRP
LLKQSDSLSKASTTDCQANSHCQCDSQGSRITSVDDDVLVNPESCNDAVNNSNNNKENTF
PTSEQRKKAALIRGPVLNVDHLLYPTEEATLYNGLKDIFESITENLSLTGIVSPTEFVKI
LKKENVLFNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDNFITDLFKGT
LTNRIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQKMLKSYHQREMLNGVNKFYCNKCY
GLQEAERMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKK
YELSGVVIHMGSGPQHGHYVCICRNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTTAY
VLFYKETQADKTENQNENIDTSSQDQMQTDNNIEQLIKCDDWLRDRKLRAAANIERKKTL
GNIPEVKTAETKTPLNDKKRNKQKRKSRILSFIK
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaagatggttatctgtgaataggaaaaagtcacacccggagaagaacactcaa
ggtaatgacgaaattaatcggaaagcaactagcctgaagaaaacgaaaggttctggagat
ccctccatagcgaaatcaccaagtgctaagagtagtacatcaagcataccttctaatctt
gcgagccatgaaagaagaagcaagtttagtagtcaaacggataaccttgcaggaaataaa
cattaccatgagcattaccataatatggcaagtacttcagatgaaagagagtacgattcc
tcgactacatatgaagatcgtgcgttcgatacagagtcctccatactatttactactatt
acagatttaatgccatatggggatggttccaataaagtgtttggttatgaaaattttggg
aatacttgctactgcaactccgttctacaatgcctttataatatccccgaatttaggtgt
aatgtgctgcgatatcctgaaagagtagccgcagtaaacagaatacgcaaaagtgatttg
aagggttcaaaaataagggtattcactaatgaaagttttgaaacatctactaatagcgga
aattctaatacggggtaccaaagcaatgataatgaagatgcacataaccaccaccacctt
cagcagagtgatcaagataactcctcttcttctactcaagaaaaacagaataattttgaa
agaaaaaggaactcgtttatgggttttggaaaagataaatcgaactataaagattctgca
aagaaagatgataacaatgagatggaacggcctcagcctgttcacacagttgtaatggcc
tctgatacattaacagagaagcttcacgaaggctgtaaaaaaattattgtgggaagaccg
cttttaaagcaaagcgattccttatcaaaagcttcaactacagattgtcaagcaaattcg
cattgccagtgtgattcacaaggcagtaggattacatcagtggatgatgatgtccttgtt
aaccctgagagctgtaacgatgctgtcaacaattctaataataataaagagaatacgttt
ccaacaagtgaacaaagaaaaaaagccgctttaattagaggccccgttcttaacgtagat
catttactttatccaaccgaggaagctacactttacaatggactaaaagatatatttgag
tctattactgaaaacttgtcgctaaccggtatcgtttcacctacagagtttgtcaaaatt
ttaaaaaaagaaaacgtcttgttcaacactatgatgcaacaagatgcccatgaattttta
aactttttattaaatgatttcagtgaatatattcaacgcaataatcccagaatgagattc
ggaccacaaaagacagacaacagcaacgacaactttataacggatttattcaaaggtaca
ctgacgaataggatcaaatgtttaacttgtgacaatatcacctcaagggacgaaccattt
ttagactttccaatagaagtacagggtgatgaagagactgatatccagaagatgttaaaa
agctatcatcagcgtgagatgttgaacggggttaacaaattttattgtaacaaatgttat
ggtttacaagaagcagaacgtatggtcggactgaagcaactgccccatattctgtcattg
cacctaaaaagattcaagtattcagaggagcaaaagtcaaacatcaaactttttaacaaa
atactctatccactaactttggatgtttcttccacttttaatacatcagtatataaaaaa
tatgaactaagcggcgtcgtcatccatatggggagcggtccacagcatggtcattacgta
tgcatttgcaggaacgaaaagtttgggtggcttttgtatgatgacgaaacggtggaatcc
ataaaagaagaaactgtgttacaattcacaggtcatccaggtgatcaaactacagcctac
gttttattctataaagaaacacaggctgataagaccgaaaatcaaaatgaaaatatagac
acttctagtcaagatcaaatgcagactgacaataacattgaacagttaataaaatgcgat
gattggttaagggatcgtaaattgagggcagctgcaaatattgaacgcaaaaagaccttg
gggaatatacctgaagttaagactgcagaaaccaagacgccattaaatgataaaaaacgc
aataagcaaaaaagaaaatcgagaatattgagcttcatcaaataa

DBGET integrated database retrieval system