KEGG   Saccharomyces cerevisiae (budding yeast): YER106W
Entry
YER106W           CDS       T00005                                 

Gene name
MAM1
Definition
(RefSeq) Mam1p
  KO
K12774  monopolin complex subunit MAM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YER106W (MAM1)
SSDB
Motif
Pfam: MAM1 SurA_N_2
Other DBs
NCBI-GeneID: 856843
NCBI-ProteinID: NP_011032
SGD: S000000908
UniProt: P40065
LinkDB
Structure
PDB: 
5CYZ 5CZO 5KTB

Position
V:372326..373234
AA seq 302 aa
MREKRTISNKDTNYLKFPNKLQRYSRFLSRKISNTSPEKQPKKNIKEHCLSSYHKEHSVK
PKQNSGNVAAKEDKDTQHLQNNVANEEATECLTRSNLKKLQEKIFDRELNDIACDHCLCS
TENRRDIKYSRLWFLFELEMSENWNENLRLSCYNKYVYSAIDESWKMENILLKEQEKHYE
YFPIGQLLIPNNIDYTNKQKRKENIEDLTIEIDSIIETNHQKKRFLPQSVLIKREDEIAF
DDFHLDARKVLNDLSATSENPFSSSPNTKKIKSKGKTLEVVPKKKNKKIIGALERKLHID
EN
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagggaaaaaagaacaatttcaaataaagacacaaactatctcaaattcccaaataaa
ctccaaagatattcccgattcttgagcaggaagatatccaataccagcccagaaaagcaa
ccgaagaagaacataaaagaacactgtttatcgagttatcataaagaacactcggtaaaa
ccaaagcaaaactccggtaatgttgcagcaaaagaagacaaagatacgcagcatttacaa
aataatgtcgctaatgaagaagcaacggaatgtctaacaagaagtaatttgaaaaagtta
caagagaaaattttcgatagagaacttaatgatattgcctgtgatcattgtctttgtagc
acagaaaatagaagagatatcaagtattcacgactttggttcctttttgagttggaaatg
agtgaaaactggaatgaaaatctccgccttagttgctataataaatatgtgtattccgca
attgatgagtcgtggaaaatggagaatattctacttaaagaacaagagaagcattatgaa
tattttccaataggacaattactgatacccaataatattgactacactaataaacagaaa
aggaaggaaaacattgaagacttaacaattgaaattgatagtattatagagacaaaccat
caaaagaaaagatttttgccgcaaagtgtcctgataaaaagggaggatgaaattgcattt
gacgactttcatttggatgcacgaaaggttctaaacgatttgagcgccacttctgaaaat
ccattcagctcttcaccaaatacaaaaaaaattaaatcaaagggaaaaaccttggaagtg
gttcccaaaaagaaaaacaaaaagatcataggtgctttggaaagaaagctacatatagat
gaaaattaa

DBGET integrated database retrieval system