KEGG   Saccharomyces cerevisiae (budding yeast): YER111C
Entry
YER111C           CDS       T00005                                 

Gene name
SWI4, ART1
Definition
(RefSeq) SBF complex DNA-binding subunit SWI4
  KO
K06649  regulatory protein SWI4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YER111C (SWI4)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YER111C (SWI4)
   04113 Meiosis - yeast
    YER111C (SWI4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YER111C (SWI4)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   ZIP only
    YER111C (SWI4)
SSDB
Motif
Pfam: Ank_2 KilA-N Ank_4 Ank Ank_3 Ank_5
Other DBs
NCBI-GeneID: 856847
NCBI-ProteinID: NP_011036
SGD: S000000913
UniProt: P25302
LinkDB
Position
V:complement(382595..385876)
AA seq 1093 aa
MPFDVLISNQKDNTNHQNITPISKSVLLAPHSNHPVIEIATYSETDVYECYIRGFETKIV
MRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQGTWIPLDSAKF
LVNKYEIIDPVVNSILTFQFDPNNPPPKRSKNSILRKTSPGTKITSPSSYNKTPRKKNSS
SSTSATTTAANKKGKKNASINQPNPSPLQNLVFQTPQQFQVNSSMNIMNNNDNHTTMNFN
NDTRHNLINNISNNSNQSTIIQQQKSIHENSFNNNYSATQKPLQFFPIPTNLQNKNVALN
NPNNNDSNSYSHNIDNVINSSNNNNNGNNNNLIIVPDGPMQSQQQQQHHHEYLTNNFNHS
MMDSITNGNSKKRRKKLNQSNEQQFYNQQEKIQRHFKLMKQPLLWQSFQNPNDHHNEYCD
SNGSNNNNNTVASNGSSIEVFSSNENDNSMNMSSRSMTPFSAGNTSSQNKLENKMTDQEY
KQTILTILSSERSSDVDQALLATLYPAPKNFNINFEIDDQGHTPLHWATAMANIPLIKML
ITLNANALQCNKLGFNCITKSIFYNNCYKENAFDEIISILKICLITPDVNGRLPFHYLIE
LSVNKSKNPMIIKSYMDSIILSLGQQDYNLLKICLNYQDNIGNTPLHLSALNLNFEVYNR
LVYLGASTDILNLDNESPASIMNKFNTPAGGSNSRNNNTKADRKLARNLPQKNYYQQQQQ
QQQPQNNVKIPKIIKTQHPDKEDSTADVNIAKTDSEVNESQYLHSNQPNSTNMNTIMEDL
SNINSFVTSSVIKDIKSTPSKILENSPILYRRRSQSISDEKEKAKDNENQVEKKKDPLNS
VKTAMPSLESPSSLLPIQMSPLGKYSKPLSQQINKLNTKVSSLQRIMGEEIKNLDNEVVE
TESSISNNKKRLITIAHQIEDAFDSVSNKTPINSISDLQSRIKETSSKLNSEKQNFIQSL
EKSQALKLATIVQDEESKVDMNTNSSSHPEKQEDEEPIPKSTSETSSPKNTKADAKFSNT
VQESYDVNETLRLATELTILQFKRRMTTLKISEAKSKINSSVKLDKYRNLIGITIENIDS
KLDDIEKDLRANA
NT seq 3282 nt   +upstreamnt  +downstreamnt
atgccatttgatgttttgatatcaaaccaaaaagataataccaatcaccagaacatcacg
ccaatatcaaaatcagttcttttggcgcctcattcaaaccatccagtgattgaaatagct
acgtattcagaaaccgatgtatacgaatgctatatacgtgggtttgaaactaaaatagtg
atgagaagaactaaagatgattggattaatattacccaggttttcaaaatagctcaattt
tcgaagacgaaaagaactaaaatactggaaaaggaatcaaatgatatgcaacatgaaaaa
gttcaaggtgggtatggtaggtttcaaggtacttggatcccactggattcagcgaagttt
ttagtcaataagtacgaaataattgaccctgtggtcaactccatcttaacttttcaattc
gatccaaataaccctccaccaaagagaagcaaaaatagtatattgaggaagacttcgccg
ggaacgaagataacttctccatcgagctacaataaaacaccaagaaaaaagaacagtagt
tcatcaacatcggctacaactacagctgcgaataagaaaggcaagaaaaatgcatcgatc
aaccagccgaatccaagtcctttacaaaaccttgttttccaaactcctcaacagttccaa
gtaaattcatcaatgaatataatgaacaataatgataaccacaccacgatgaatttcaac
aatgacacaagacacaatttaataaataatattagtaacaacagcaatcaatctactatt
attcaacaacaaaaatccattcatgaaaactctttcaataataattattcggcaactcag
aaacctcttcaattttttccaattccgacaaatttacaaaacaagaacgttgctctgaat
aaccctaataataatgacagtaatagttacagccataacatcgacaatgtcattaacagc
agtaataacaataataatggcaataataataacttgatcatagttccagacggacctatg
caaagccaacaacaacaacaacatcatcatgaatatttgacgaataacttcaatcattcc
atgatggactccattacaaatggcaatagtaaaaaaaggaggaaaaagctgaatcaatct
aatgaacaacaattttacaaccagcaagaaaaaatacaaaggcatttcaaattaatgaag
caacccttattatggcaatcctttcaaaatccaaatgatcaccataatgagtactgtgac
agtaacggcagcaacaataacaacaacactgtagcatccaatggctcctccattgaagta
ttttcatcaaatgaaaatgataacagtatgaatatgtcttcacgatctatgacaccgttc
agcgcaggaaatacttcatctcaaaacaagttggaaaacaaaatgacagatcaagaatac
aagcagacgatattaacaatactatcatcggaaaggtcttctgatgtagatcaagcgttg
ttggctactttatatccggcgcccaaaaattttaacataaattttgaaattgatgatcaa
ggtcacactccactccattgggctacagctatggcgaatattcctttgataaaaatgcta
attaccttaaatgctaatgcattacagtgtaataagctcggttttaattgcatcacaaaa
tcaattttctacaacaattgctacaaggagaatgctttcgatgaaataatatccatctta
aaaatatgtcttataactcccgacgtaaatggaagattgccatttcattatttaattgaa
ttgagcgttaataagtccaaaaatccaatgataataaaatcttatatggattcgataata
ttgagcttgggtcagcaggactacaatttgttgaagatatgtttgaactaccaagataat
atagggaacactccactgcatttatctgctttaaacttgaacttcgaggtttacaacaga
ctggtatatcttggtgcgtcaacagatatattgaatctagataacgaatcgcctgcgtca
ataatgaataagtttaatactccggctggcgggtcaaacagcagaaacaacaacaccaag
gcagatcgaaagttagctcgaaaccttcctcaaaagaattattaccaacaacagcaacag
caacagcaaccacaaaacaatgtcaaaattccaaaaattataaaaactcaacatcctgat
aaagaagattctactgcagatgtcaatatagctaaaacagattctgaagtcaacgaaagt
caatacctgcattccaaccagccaaattctacaaatatgaacactattatggaagacttg
tcgaatattaattctttcgtgacgtcgtctgtcattaaagatataaagtctacgccgtcc
aaaattcttgaaaactctcccattttatacagaagaagatcacagtcaatatcagatgaa
aaagaaaaggcaaaggataatgagaatcaagttgaaaagaaaaaggatcccttgaatagt
gtgaaaactgccatgccatcattggaatcgccttcttcccttctgccgatacagatgtct
ccactaggaaagtactcaaaaccgctttcgcagcagatcaacaaattaaatacaaaagtt
tcttctctacaaagaataatgggtgaagaaattaaaaatctggacaacgaagtagtagaa
accgaatcctctatttctaacaataagaagagattgattacaatagcacatcaaatagag
gatgctttcgattccgtatcaaacaaaactcccataaattcgatatcagatttacaatca
aggattaaagaaacatcgtcaaagttgaattctgaaaagcaaaattttattcaaagcttg
gaaaaatctcaagctttaaaactggctacaattgtccaggatgaggaatcaaaggttgat
atgaatactaactcaagttcacatccagaaaaacaggaagatgaagagccaattccaaag
tcaacgtcggaaacttcttctcctaaaaacaccaaagcggacgccaaattttctaatact
gtacaagaatcatatgatgtaaatgagacgttgagactagcaacggaactaactattcta
cagtttaaaagaaggatgacaacattgaaaataagcgaagctaaaagcaaaattaattca
tcggtgaagttagataaatacagaaacttgattggtatcacaattgagaacattgactca
aaattggacgatatagaaaaggatttgagggcaaacgcataa

DBGET integrated database retrieval system