KEGG   Saccharomyces cerevisiae (budding yeast): YER173W
Entry
YER173W           CDS       T00005                                 

Gene name
RAD24
Definition
(RefSeq) Rad24p
  KO
K06662  cell cycle checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YER173W (RAD24)
   04113 Meiosis - yeast
    YER173W (RAD24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER173W (RAD24)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   HRAD17(Rad24)-RFC complex
    YER173W (RAD24)
SSDB
Motif
Pfam: Rad17 AAA_16 AAA_29 RNA_helicase RsgA_GTPase Mg_chelatase AAA_7 AAA AAA_5
Other DBs
NCBI-GeneID: 856920
NCBI-ProteinID: NP_011100
SGD: S000000975
UniProt: P32641
LinkDB
Position
V:536300..538279
AA seq 659 aa
MDSTNLNKRPLLQYSLSSLGSQITKWSSSRPTSPVRKARSTENDFLSKQDTSSILPSIND
DGGEQWYEKFKPNCLEQVAIHKRKLKDVQEALDAMFLPNAKHRILLLSGPSGCSKSTVIK
ELSKILVPKYRQNSNGTSFRSTPNEHKVTEFRGDCIVNDLPQMESFSEFLKGARYLVMSN
LSLILIEDLPNVFHIDTRRRFQQLILQWLYSSEPLLPPLVICITECEIPENDNNYRKFGI
DYTFSAETIMNKEILMHPRLKRIKFNPINSTLLKKHLKFICVQNMKMLKEKNKWNKRQEV
IDYIAQETGDIRSAITTLQFWATSSGSLPISTRESTISYFHAIGKVIHGSHSTNNDNEMI
NNLFENSNNLLSKEDFKLGILENYNTFNKGEFSISDASSIVDCLSECDNMNGLPESNEYG
LREVRKTFRNISKQGHNHGTVYFPREWKVRKLQNSFKVQAEDWLNVSLYKYNAVHSFRNI
TLEFGYYAPLIRKCQSYKKKYILYYLKNLPSGSSGPKQTMDKFSDIMKVENGIDVVDRIG
GPIEALSVEDGLAPLMDNDSNNCDHLEDQKKERDRRLRMLIDQYERNVMMANDDLEDEET
SFNDDPIVDSDSDNSNNIGNETFGRSDEDESLCEILSQRQPRKAPVISESLSDSDLEIL
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggatagtacgaatttgaacaaacggcccttattacaatatagtctcagttcattgggc
tcgcaaataacaaaatggagctcatctagaccgacttcgccagttcgtaaggcgagaagc
actgaaaatgactttctttccaagcaagatacgtctagtatcctcccaagtatcaacgac
gacggcggtgaacagtggtacgaaaagttcaagcccaattgtttggagcaagtggccata
cataaaagaaaacttaaagatgtacaagaagctttagatgccatgtttttacctaacgcc
aagcataggatcctactactgtctggccccagtggatgctctaaaagtacggtcataaaa
gaactctcaaaaatcttagttcctaaatacagacaaaacagcaacggaacgtcctttcga
agcaccccgaacgagcataaagtgaccgagtttagaggtgattgtatagtcaacgatctt
cctcagatggaaagctttagtgagttcttaaaaggcgcacggtatcttgtgatgtccaac
ctgtcattaatacttatcgaggaccttcccaacgtcttccatatagataccagacgtcga
tttcaacaacttatattacagtggctatatagttcggagcctctattacctccccttgtt
atatgtataactgaatgtgaaattccagagaacgataataattatcgcaaatttggtatt
gattatacatttagtgcagaaaccataatgaacaaagaaatattgatgcatccaaggttg
aaaagaattaagtttaatccaattaacagcactttattaaaaaagcacttgaaatttatt
tgtgtacagaatatgaaaatgttgaaggagaaaaataaatggaataaaagacaggaagtc
atagattatattgcgcaagagactggtgatattaggtcggccattacgacccttcaattt
tgggcgacatcaagtggaagtttgccgatttcaacccgagaatccaccatatcatacttt
catgccattgggaaggtgatacatggttcccatagcacgaataacgataacgaaatgatt
aataacctcttcgaaaattcgaacaatttgttatcgaaagaggatttcaaattaggaata
ttagagaactataacacatttaataaaggcgaattcagcatttctgatgcatcatcaatt
gtggattgcctgagcgagtgtgataatatgaatggtctaccagaatccaatgagtatggt
ttacgagaagtgcgcaaaacctttcgtaacatcagtaaacaaggccataatcatggaacg
gtttattttccaagagaatggaaagtaagaaaattacaaaattcatttaaagttcaagct
gaagattggttaaatgttagtctttataagtacaacgcggtacattctttcaggaatata
actctagaatttggctactacgcacctctaattagaaagtgtcagagttataaaaaaaaa
tacattctctattatttgaagaatcttccgagtggctcctcggggcccaaacaaaccatg
gacaaatttagtgatataatgaaagttgagaacggaatcgacgttgtggatcggataggc
gggcctatcgaagcactatctgtggaggatggactagcaccattgatggataatgatagc
aataattgtgaccatttagaggatcaaaaaaaggaaagggacagaaggcttcgcatgttg
attgaccaatatgaaagaaatgtgatgatggctaacgacgatcttgaagacgaagaaact
tcttttaatgatgaccctattgtcgatagcgatagcgataacagcaataatattggcaat
gaaacatttggtagaagcgacgaagacgagtctctatgtgaaattctgtcccagagacag
ccgcgtaaagcgccagttatcagtgagtccctttcagattcagatctggaaatactctaa

DBGET integrated database retrieval system