KEGG   Saccharomyces cerevisiae (budding yeast): YER179W
Entry
YER179W           CDS       T00005                                 

Gene name
DMC1, ISC2
Definition
(RefSeq) recombinase DMC1
  KO
K10872  meiotic recombination protein DMC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YER179W (DMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER179W (DMC1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     YER179W (DMC1)
SSDB
Motif
Pfam: Rad51 RecA AAA_25 ATPase HHH_5 RNA_pol_A_CTD PAXNEB
Other DBs
NCBI-GeneID: 856926
NCBI-ProteinID: NP_011106
SGD: S000000981
UniProt: P25453
LinkDB
Position
V:join(548421..548552,548645..549517)
AA seq 334 aa
MSVTGTEIDSDTAKNILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGL
SEVKVEKIKEAAGKIIQVGFIPATVQLDIRQRVYSLSTGSKQLDSILGGGIMTMSITEVF
GEFRCGKTQMSHTLCVTTQLPREMGGGEGKVAYIDTEGTFRPERIKQIAEGYELDPESCL
ANVSYARALNSEHQMELVEQLGEELSSGDYRLIVVDSIMANFRVDYCGRGELSERQQKLN
QHLFKLNRLAEEFNVAVFLTNQVQSDPGASALFASADGRKPIGGHVLAHASATRILLRKG
RGDERVAKLQDSPDMPEKECVYVIGEKGITDSSD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctgttacaggaactgagatcgatagtgatacagcaaaaaatattcttagtgtagat
gaattacagaactatggtattaatgcctcagatcttcaaaaattgaagtctggtgggata
tacacagtcaataccgttttgtcaacaacaagaagacatctatgtaaaattaaagggtta
agtgaggtgaaagtggaaaaaattaaagaagctgctggaaaaatcatacaggtgggattt
atccccgctactgtacaattagatataagacagcgtgtgtactccttatcaactggatct
aagcaactagattcaatcctaggtggtggaataatgacaatgagtatcactgaagtattt
ggtgaatttaggtgtggtaagacacagatgtctcatactttgtgtgttaccacgcagctt
ccgagggaaatgggtggtggtgaagggaaagtagcatatattgatacagaaggcactttc
aggcccgagaggattaagcaaattgcagaaggttatgaattggatcccgagtcatgtttg
gcaaacgtttcatatgctagagccttgaatagtgaacatcaaatggaacttgttgaacaa
ttgggtgaagaacttagttctggagattatcgccttatcgtggtagattctataatggca
aacttcagagtagactactgcggtagaggtgaactaagcgaaagacagcaaaagctaaat
caacatcttttcaaattgaatagattggcagaggaatttaatgttgcagtatttctgaca
aaccaagttcaatcagacccaggtgcttctgcattatttgcctcggcagatggtaggaaa
ccaattggagggcacgttctggcacatgcgtcagcaacaaggattttgttgagaaaaggg
cgtggtgacgaaagagttgccaagttacaagattccccagatatgcctgaaaaagaatgt
gtctacgtaattggtgaaaaaggtattaccgattcaagtgactag

DBGET integrated database retrieval system