KEGG   Saccharomyces cerevisiae (budding yeast): YFR028C
Entry
YFR028C           CDS       T00005                                 

Gene name
CDC14, OAF3
Definition
(RefSeq) phosphoprotein phosphatase CDC14
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFR028C (CDC14)
   04113 Meiosis - yeast
    YFR028C (CDC14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YFR028C (CDC14)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YFR028C (CDC14)
    3.1.3.48  protein-tyrosine-phosphatase
     YFR028C (CDC14)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    YFR028C (CDC14)
SSDB
Motif
Pfam: DSPn DSPc Y_phosphatase CDKN3 PTPlike_phytase
Other DBs
NCBI-GeneID: 850585
NCBI-ProteinID: NP_116684
SGD: S000001924
UniProt: Q00684
LinkDB
Structure
PDB: 

Position
VI:complement(208413..210068)
AA seq 551 aa
MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLY
RFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQV
DPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNV
LTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFE
DIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIY
TYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLI
SLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNSSQPSTANNGSNSF
KSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSN
HYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAG
GIRKISGSIKK
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcgtaggagtgtatacctcgacaacacgatcgagttcctgcgaggcagagtatatctc
ggtgcatatgattacacgccggaagatactgatgagctggtgttttttaccgtggaggac
gcaatcttttacaacagtttccatttggatttcggtcccatgaacattggacatctatat
cgttttgccgttattttccatgaaatcttgaatgacccagaaaatgccaataaagccgtt
gttttctattcatctgcatcgaccagacaacgtgctaacgccgcatgtatgctttgctgt
tatatgatcctcgttcaggcatggactccgcatcaagtgcttcagccgttggcgcaagta
gaccctcccttcatgccatttagagatgccggttattctaatgcggatttcgaaatcaca
attcaagatgtggtttatggcgtttggagggctaaggaaaaaggccttattgatttgcat
tccttcaatttggagagttacgagaaatacgaacacgtggagtttggagacttcaatgta
ctcaccccagattttattgcatttgcgtcaccacaagaggaccatccaaagggctatctc
gctaccaaatcttcacatttgaaccagccgtttaagtcagttctgaattttttcgccaac
aataacgtccaattagtggtaaggttgaattctcatttatataataaaaagcattttgaa
gacattggcattcaacatttggatctaattttcgaagatggtacatgtcctgatctttcc
attgtaaaaaactttgttggtgctgctgaaacgataattaaaaggggaggtaaaattgct
gtgcactgtaaggctgggctaggtagaactggttgtttaattggtgctcacttaatatac
acgtatggatttaccgctaacgagtgtattggcttcttaaggtttataaggccgggaatg
gtcgttggccctcaacagcattggttatatttacaccagaatgattttagagaatggaag
tacacaaccagaatttctttgaagcctagtgaggccattggcggcttatatcccttaata
agtttagaagaataccgcttacaaaaaaagaaacttaaagacgacaagagggttgcgcaa
aataacattgaaggtgaattaagagatttaaccatgacgccgccatccaacggtcatggg
gcgcttagtgccagaaattcgagccaaccttctacggcgaataatggaagtaattcattc
aagagctcagccgtcccacagacttcgcctggtcagccgagaaagggccaaaacggttct
aatactatagaagatatcaacaataatcgtaatccaacttcccatgcgaataggaaggta
gtaatagaaagcaacaactcagatgacgaatccatgcaggataccaacggcacaagtaat
cattatcccaaagtttcgcgcaagaaaaatgatatctcctctgcttcatcgtcccgaatg
gaagataacgaacccagcgcaacgaacatcaataatgccgcagatgataccatactaaga
caactattgcccaagaataggagagtaacgtcagggagaaggactacaagcgccgccggt
ggtataagaaaaataagtggctccatcaagaaataa

DBGET integrated database retrieval system