KEGG   Saccharomyces cerevisiae (budding yeast): YGL253WHelp
Entry
YGL253W           CDS       T00005                                 

Gene name
HXK2, HEX1, HKB, SCI2
Definition
(RefSeq) hexokinase 2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00051  Fructose and mannose metabolism
sce00052  Galactose metabolism
sce00500  Starch and sucrose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YGL253W (HXK2)
   00051 Fructose and mannose metabolism
    YGL253W (HXK2)
   00052 Galactose metabolism
    YGL253W (HXK2)
   00500 Starch and sucrose metabolism
    YGL253W (HXK2)
   00520 Amino sugar and nucleotide sugar metabolism
    YGL253W (HXK2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YGL253W (HXK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YGL253W (HXK2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     YGL253W (HXK2)
Membrane trafficking [BR:sce04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    YGL253W (HXK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 852639
NCBI-ProteinID: NP_011261
SGD: S000003222
UniProt: P04807
LinkDB All DBs
Structure
PDB: 

Position
VII:23935..25395
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFISELEKGLSKKG
GNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRT
TQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFTFSFPASQNKINEGILQRWTKGFDI
PNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAY
YDVCSDIEKLQGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT
FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARIEEDPFENLED
TDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGIAAICQKRGYKTGHIAADGSV
YNRYPGFKEKAANALKDIYGWTQTSLDDYPIKIVPAEDGSGAGAAVIAALAQKRIAEGKS
VGIIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaaaaaaccacaagccagaaagggttccatggccgatgtgcca
aaggaattgatgcaacaaattgagaattttgaaaaaattttcactgttccaactgaaact
ttacaagccgttaccaagcacttcatttccgaattggaaaagggtttgtccaagaagggt
ggtaacattccaatgattccaggttgggttatggatttcccaactggtaaggaatccggt
gatttcttggccattgatttgggtggtaccaacttgagagttgtcttagtcaagttgggc
ggtgaccgtacctttgacaccactcaatctaagtacagattaccagatgctatgagaact
actcaaaatccagacgaattgtgggaatttattgccgactctttgaaagcttttattgat
gagcaattcccacaaggtatctctgagccaattccattgggtttcaccttttctttccca
gcttctcaaaacaaaatcaatgaaggtatcttgcaaagatggactaaaggttttgatatt
ccaaacattgaaaaccacgatgttgttccaatgttgcaaaagcaaatcactaagaggaat
atcccaattgaagttgttgctttgataaacgacactaccggtactttggttgcttcttac
tacactgacccagaaactaagatgggtgttatcttcggtactggtgtcaatggtgcttac
tacgatgtttgttccgatatcgaaaagctacaaggaaaactatctgatgacattccacca
tctgctccaatggccatcaactgtgaatacggttccttcgataatgaacatgtcgttttg
ccaagaactaaatacgatatcaccattgatgaagaatctccaagaccaggccaacaaacc
tttgaaaaaatgtcttctggttactacttaggtgaaattttgcgtttggccttgatggac
atgtacaaacaaggtttcatcttcaagaaccaagacttgtctaagttcgacaagcctttc
gtcatggacacttcttacccagccagaatcgaggaagatccattcgagaacctagaagat
accgatgacttgttccaaaatgagttcggtatcaacactactgttcaagaacgtaaattg
atcagacgtttatctgaattgattggtgctagagctgctagattgtccgtttgtggtatt
gctgctatctgtcaaaagagaggttacaagaccggtcacatcgctgcagacggttccgtt
tacaacagatacccaggtttcaaagaaaaggctgccaatgctttgaaggacatttacggc
tggactcaaacctcactagacgactacccaatcaagattgttcctgctgaagatggttcc
ggtgctggtgccgctgttattgctgctttggcccaaaaaagaattgctgaaggtaagtcc
gttggtatcatcggtgcttaa

DBGET integrated database retrieval system