KEGG   Saccharomyces cerevisiae (budding yeast): YGR044C
Entry
YGR044C           CDS       T00005                                 

Gene name
RME1, CSP1
Definition
(RefSeq) Rme1p
  KO
K09235  zinc finger protein RME1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YGR044C (RME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YGR044C (RME1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    YGR044C (RME1)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-met zf-C2HE
Other DBs
NCBI-GeneID: 852935
NCBI-ProteinID: NP_011558
SGD: S000003276
UniProt: P32338
LinkDB
Position
VII:complement(582990..583892)
AA seq 300 aa
MSPCYGQNSAIAKGSWNREVLQEVQPIYHWHDFGQNMKEYSASPLEGDSSLPSSLPSSTE
DCLLLSLENTITVIAGNQRQAYDSTSSTEEGTAPQLRPDEIADSTHCITSLVDPEFRDLI
NYGRQKGANPVFIESNTTEQSHSQCILGYPQKSHVAQLYHDPKVLSTISEGQTKRGSYHC
SHCSEKFATLVEFAAHLDEFNLERPCKCPIEQCPWKILGFQQATGLRRHCASQHIGELDI
EMEKSLNLKVEKYPGLNCPFPICQKTFRRKDAYKRHVAMVHNNADSRFNKRLKKILNNTK
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcaccgtgttatggacaaaacagtgccatcgccaaggggtcttggaacagagaggtt
ttacaagaggtgcaaccgatttatcattggcacgatttcgggcaaaacatgaaagaatat
tcggcatcacccttagagggggattccagcctgccttccagcctgccttccagcactgag
gactgtttactactatcattagaaaacacaatcacagttatagccggaaatcagagacag
gcttatgactctacgtcgtctactgaggaaggtacagcacctcaattacggccggatgaa
atagcggacagtacacactgtatcacgtcattagttgatccggagttcagagatcttatt
aattatggacgtcaaaaaggagcaaatcctgtatttattgagagcaatacaacagaacaa
tcccattcacagtgtattctaggctatccccaaaaatcgcacgtggcacagctatatcac
gaccccaaagtactcagcacaatttccgaagggcaaacaaaaagaggaagttaccactgt
tctcattgttctgaaaagttcgcaacgttagttgagtttgccgcgcacttagacgaattc
aaccttgaaagaccgtgtaagtgtcccatagagcaatgtccctggaaaatattgggtttc
caacaagcaactggtctgagaagacattgtgcttcccaacatataggagagcttgatata
gagatggagaaatcattaaatctaaaagtagaaaaatatccaggactgaattgcccattt
cctatctgtcagaaaacgtttaggcgcaaagacgcctataagagacatgtggccatggtg
cataacaacgctgattcaagatttaacaagcgtttgaagaaaattttgaacaataccaaa
tag

DBGET integrated database retrieval system