KEGG   Saccharomyces cerevisiae (budding yeast): YGR059W
Entry
YGR059W           CDS       T00005                                 

Gene name
SPR3
Definition
(RefSeq) septin SPR3
  KO
K12773  sporulation-regulated protein 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YGR059W (SPR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YGR059W (SPR3)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 4
     YGR059W (SPR3)
SSDB
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 NB-ARC AIG1 FPP CCDC92 AAA_24 S6PP YxiJ
Other DBs
NCBI-GeneID: 852950
NCBI-ProteinID: NP_011573
SGD: S000003291
UniProt: P41901
LinkDB
Position
VII:607563..609101
AA seq 512 aa
MKSKGSRLSTDCPVEFPKIVSGFAEEVKIRRQSSQGQYAVDSHPPKSPELKHRRQRSSSF
VNGKCRNRDLPLLDNKKAQEINTNSHGQDIGIKNLPRQRELLNAKNGIDFTLMVAGQSGL
GKTTFINSLFSTSLIDDDIKENKPIIRYKSIVEGDGTHLNFNVIDTPGFGNNMDNAFTWR
TMVNYIDEEIRSYIFQEEQPDRTKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVN
LIPVIAKSDLLTKEELKNFKTQVREIIRVQDIPVCFFFGDEVLNATQDIFQKYPFSIIAS
NEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTEDYYEKCRS
EMLRTRLLKARDCLTTKSVDITEEQRKFLEEEMNFDEIEENKLKNYKCYEIINKTVMDKV
ATEWDPEFITRQLEAKKKFNELSNREISKFRDWKKSLFMEQENFNQEIEQLNHKLENLQL
ECQDLEYKLLIGKSSNSHSTDSATLVNVHIKR
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaagtcaaaagggagtcggttgtcaacagactgtcctgtcgaatttcccaagatagtc
tctggattcgctgaggaagtgaaaatacgtagacaaagttcccaaggacagtacgccgtc
gattcacatcctccgaaaagccctgaactgaaacacagaagacagaggtcatcctctttt
gttaacggtaaatgcaggaacagggaccttccattgttagataacaagaaagcacaagaa
ataaacaccaattcacacggccaagacatcggtatcaaaaacttaccacgtcaacgtgag
ttgttgaatgccaaaaatggaattgattttacgctgatggtggcgggtcaaagtggattg
ggtaaaaccacgtttatcaattccttattttctacttctttaattgatgatgacatcaaa
gaaaacaaacctattattcgttataaaagcattgtagaaggagatggaacacaccttaat
ttcaacgtcatcgatacacctggttttggtaacaatatggataatgcatttacgtggagg
acaatggttaactatattgatgaagaaataagatcgtacattttccaagaagaacaacct
gataggacaaaaatggttgataatagagtccattgttgtttgtactttctgagaccttca
aataagggaattgatactttagacgtcgtaacaatgaaaaaattagcgaagagagtgaat
ttaatcccggttattgctaaatcagatttgctaacgaaagaggaattgaaaaacttcaaa
acacaagttagagaaataataagagtacaagatatccctgtatgtttctttttcggcgat
gaagttttgaatgcaacacaagatatttttcaaaaatatccattcagtataattgcatct
aatgagtacatttttaatgaaaagggcgaaaaagttaaaggaagacaatacaaatggggc
gctgttgacattgaaaatgaaaagtactgtgacttcaaaatcttgcaaaagacgattttt
gattggaatttaattgatcttgtagaaagtaccgaggattattatgaaaaatgcagatct
gaaatgctaagaactaggctattaaaggccagagattgcttaacaacgaaaagtgttgac
ataacggaagaacaaaggaaatttttggaggaagaaatgaacttcgatgaaatcgaggaa
aacaaactcaaaaattacaagtgctatgaaataattaataaaacggtcatggataaggtg
gctacagaatgggatcctgaatttataactagacaattagaagctaagaaaaaattcaac
gagctgtccaacagagaaatttcaaaatttcgagactggaaaaagagcctattcatggaa
caagagaattttaaccaagagattgaacaattgaatcacaagttggaaaacttacaactg
gaatgtcaggacttggaatacaagctgttaatcggaaaaagttccaacagccattccaca
gatagtgctactttagtaaacgttcacatcaaaaggtag

DBGET integrated database retrieval system