KEGG   Saccharomyces cerevisiae (budding yeast): YGR225W
Entry
YGR225W           CDS       T00005                                 

Gene name
AMA1, SPO70
Definition
(RefSeq) Ama1p
  KO
K12782  meiosis-specific APC/C activator protein AMA1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YGR225W (AMA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YGR225W (AMA1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     YGR225W (AMA1)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 853140
NCBI-ProteinID: NP_011741
SGD: S000003457
UniProt: P50082
LinkDB
Position
VII:join(945145..946327,946421..947019)
AA seq 593 aa
MATPHLYHRYNSKSSNKNINSSGNSTEVDRFIPKSVSRNAYKSIPMLNGFDISYSELCEK
SPSPERLSSPEFFNELRNTGHYESISTTNEFSMSSISSSSESQVTRSGSARASRNDYSKL
TKEQKDHRKNIAHSLGFQLPDRVFTFETTSAEILEKNKAIKNCFGPGSCAEIRSTFDFST
LSPDVARYYIANSNARSASPQRQIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTT
NNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLY
DQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLH
FPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDIS
DLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQ
VTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSM
AICVATNDETIRFYELWNDKEEIINEIQESGIYGSNIIEYMEGIETTHNKRIR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggctactccccatttatatcacagatataactccaaaagctctaacaaaaatatcaat
tcgagcggaaattctacagaggttgaccgtttcattccaaaatcagtttcgagaaatgct
tataagtctattccaatgttaaatgggtttgacataagttactcagaactttgcgagaaa
tctccttcacctgagcggctatcatcccctgaattctttaacgaactgcgaaacaccggg
cattacgaatcaatcagtacaacaaatgagttttccatgtcaagtatctctagctcttct
gagagtcaagttaccagaagtggaagtgcaagagcttcaagaaacgattattcaaaatta
actaaagagcaaaaggaccatagaaagaatattgcacattctcttggttttcaattgccc
gaccgtgtctttacgtttgagaccacaagtgctgaaattctggaaaagaataaagccatc
aaaaattgctttggaccaggaagttgcgccgaaataagatcaacctttgactttagtaca
ctctcgcccgatgttgcccgttattatatcgctaattctaacgcaagatcagcttcccca
caaagacaaatccaaagacctgctaaacgagtaaagtcacatattccataccgtgtattg
gatgcaccttgcctgagaaatgatttttattcgaacttaatttcttggtcaagaaccaca
aacaacgttttggtgggactgggttgctccgtatacatctggtctgagaaagaaggagcg
gtatctatattggaccatcaatacttaagtgaaaagagggatttagtgacatgcgtctca
ttctgtccttacaatacttattttattgttggtacaaaatttggccgtattcttctttat
gatcaaaaagaattttttcattccagcaacacaaacgaaaaggaaccagtatttgttttc
caaactgaatccttcaaaggaatatgttgcctagaatggttcaaaccaggtgaaatttgc
aaattttatgttggagaggaaaatggcaatgtgagcctctttgaaataaagagtttgcat
ttccccataaaaaactggagtaaaagacaaaaactcgaagatgaaaatttaataggattg
aaacttcattccacttatcaagctcaggcacagcaagtctgtggtatttctctgaatgaa
catgcaaacctgcttgcagtcggcggcaatgataattcttgtagcttatgggatatttcc
gacttggataaacctattaaaaagtttgttcttccacataaagcggctgtgaaggccatt
gccttttgtccttggtcgaagtctttgttggctacgggtggtggaagcaaagacagatgt
attaagttttggcatacatcgacaggcacattgttggatgagatttgcacctcgggacag
gtgacgtctttgatatggtcgttgagacataaacagattgttgctacttttggattcggt
gataccaagaatcctgtattaataacactatactcatatccaaaattatcaaaactactc
gaagttaggtcgcccaaccctttgcgtgtactgagcgcagtaatctctccaagttccatg
gcaatttgcgttgccactaacgatgaaacgataagattttatgaactgtggaacgataag
gaggaaataattaatgaaattcaagagagtgggatttatggatctaatattatagaatat
atggagggtatcgaaacaacacataacaaaagaataaggtaa

DBGET integrated database retrieval system