KEGG   Saccharomyces cerevisiae (budding yeast): YHL022C
Entry
YHL022C           CDS       T00005                                 

Gene name
SPO11
Definition
(RefSeq) DNA topoisomerase (ATP-hydrolyzing)
  KO
K10878  meiotic recombination protein SPO11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHL022C (SPO11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YHL022C (SPO11)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     YHL022C (SPO11)
SSDB
Motif
Pfam: TP6A_N Hydant_A_N
Other DBs
NCBI-GeneID: 856364
NCBI-ProteinID: NP_011841
SGD: S000001014
UniProt: P23179
LinkDB
Position
VIII:complement(62961..64157)
AA seq 398 aa
MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIKHFLSLAANSL
EQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCTHQFKLKRCAILLNLLKVVME
KLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNIIPAQKGLVYSPF
PIDIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTK
LVNNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNY
THSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAKNLIASLTANS
WDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggctttggagggattgcggaaaaaatataaaacaaggcaggaattggtcaaagcactc
actcctaaaagacggtccattcacttgaactccaatggtcactccaacggaactccctgt
tcaaacgcagatgttttggctcatattaagcatttcctgtcattggcggctaattcatta
gagcaacatcaacagcctatttcaatcgtctttcaaaacaaaaaaaaaaaaggcgataca
agcagtcctgacattcacacaacattggacttccctttgaatggcccgcatctatgcact
catcagttcaagttgaaaagatgcgcaatccttttaaacttattgaaagtcgttatggaa
aaattaccgctaggtaaaaacactacagtgagagatatcttctactccaacgtggaattg
tttcaaagacaagcaaacgtagtccagtggctggacgttatacgctttaatttcaagctc
tctccaagaaaatccttaaacattataccagctcaaaagggtttagtttattcgcctttc
cccattgatatttatgacaatattctgacatgtgaaaatgaaccaaagatgcaaaagcaa
acaattttccctggtaagccctgtctaattccatttttccaagatgatgcggtcatcaag
ttagggacaacaagtatgtgtaatattgtaatagtggaaaaagaagctgtcttcaccaaa
ttagtaaataattatcacaagttgagtacaaataccatgctcattacaggtaagggattt
ccagatttcttgacaaggttattcctaaaaaaactagaacaatattgctccaaattgata
tcggactgttctatatttaccgatgcggacccctatgggattagcatagccctaaattat
actcactcgaatgaacgcaacgcttatatttgcacgatggcaaactataaaggaattcgt
attacgcaagttttggcacaaaataatgaagtgcataacaaatccattcaattattgagt
ttgaatcagcgcgactactccttagccaagaatttgatagcatctctgactgccaacagc
tgggatattgcaacttcaccattaaagaacgtcatcatagaatgtcagcgggaaattttt
ttccaaaagaaagctgaaatgaacgagattgatgccagaatttttgaatacaaatga

DBGET integrated database retrieval system