KEGG   Saccharomyces cerevisiae (budding yeast): YHR124W
Entry
YHR124W           CDS       T00005                                 

Gene name
NDT80
Definition
(RefSeq) transcription factor NDT80
  KO
K12769  meiosis-specific transcription factor NDT80
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHR124W (NDT80)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YHR124W (NDT80)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Other transcription factors
   Others
    YHR124W (NDT80)
SSDB
Motif
Pfam: NDT80_PhoG
Other DBs
NCBI-GeneID: 856524
NCBI-ProteinID: NP_011992
SGD: S000001166
UniProt: P38830
LinkDB
Structure
PDB: 

Position
VIII:356561..358444
AA seq 627 aa
MNEMENTDPVLQDDLVSKYERELSTEQEEDTPVILTQLNEDGTTSNYFDKRKLKIAPRST
LQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTF
ETANCDLDTFLKSSFDLLVEDSSVESRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKG
PQFCPSVCPLVPSPLPKHQIIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFS
YPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDTFHGENPGIPYDEL
ALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQRITVRTPSSVNSSQNSTKRKMPSMA
QPLNESCLNARPSKRRSKVALGAPNSGASISPIKSRQSTPMEASKENEDPFFRPNKRVET
LEHIQNKLGALKNQCPDSSLKYPSSSSRGMEGCLEKEDLVYSSSFSVNMKQIELKPARSF
EHENIFKVGSLAFKKINELPHENYDITIEKKSMEQNYLRPEIGSRSECKTSYGNELSLSN
ISFSILPNSAENFHLETALFPATEEDVPRTFSRILETGSFQNYYQKMDAENADRVYSKGV
KLIASGTLPSGIFNREELFEEDSFYKY
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgaatgaaatggaaaacacagatccagtattacaggatgatctcgtatccaaatatgag
agggaattaagcacagaacaggaagaggatacgcctgttatccttacgcagttgaatgaa
gatggcaccacttcgaattatttcgacaaaaggaaactaaaaattgcccctagatcaaca
ctacagttcaaagtgggacctccatttgaattagtgagagattattgtccagtcgttgag
tctcataccggaagaacactagatttacgaattattccaagaattgacagagggttcgac
catattgatgaagagtgggtaggttataaaagaaattattttaccttagtatcaacgttt
gaaacggcaaattgtgatttggatacttttttaaagagcagttttgatcttctcgttgaa
gactcttcagtagaaagcagattaagagtgcaatatttcgctatcaaaataaaagctaag
aatgacgacgacgacacggaaatcaatctcgtccagcatacagcgaaacgcgacaaaggt
cctcaattttgtccttcagtatgtccgttggtgccttcccctttgccaaaacatcaaatc
ataagagaagcttcaaatgttcgaaatatcactaaaatgaaaaaatacgattccactttt
tatttgcacagagaccacgttaattatgaagaatatggagtggactctttattgttttcc
tatccagaagattctattcagaaagttgcccgttatgaaagagttcaatttgcttcatca
attagcgtgaagaaaccatcccaacaaaataaacactttagcttgcatgtaattttaggt
gcagtggtagatccagatacctttcatggggagaatcccggaattccttatgatgaactg
gctttaaaaaatggatcaaaagggatgtttgtgtatttgcaagaaatgaaaacgcctcct
cttattattagaggaagatcaccttctaactatgcgtcatctcagcgaataactgtgaga
acaccgtcgagtgtcaattcctcacaaaacagcacaaaaagaaaaatgccatcaatggcg
cagccgttaaatgaaagttgcttaaatgcaagaccttcgaaaaggcgatccaaagtggcg
ctaggtgcaccgaactctggggcctccatctcgcctatcaaatctcgtcaatccacacca
atggaagcttcgaaggaaaatgaggatccgttcttcaggccaaataaaagggtggagact
cttgaacatatccagaacaaactgggtgctttgaaaaatcaatgtccagattcctctctg
aaatatccgagttcatcttcaagaggtatggaagggtgtttagaaaaggaggatttagtt
tactcaagtagtttttctgttaatatgaagcaaatcgaactgaaaccggcacgctctttt
gaacatgagaatattttcaaagtaggctcattagcattcaaaaaaatcaatgaattacct
catgaaaattatgatataacaatagagaagaaatcaatggaacagaattatctaagacca
gagataggctcacgttctgaatgcaaaacaagctatggtaacgaactctccctttcaaat
atttctttctctatactacctaactcagcagaaaattttcacttggaaactgcacttttc
ccagctacggaagaggatgtgccaaggacattttcaagaatattagaaacaggttcgttt
caaaattattatcaaaaaatggatgcagaaaatgcagatagggtatattcgaaaggggtc
aagttgattgcaagcggtactctaccatctggtatatttaatagggaagaattgtttgag
gaagatagtttctataagtattaa

DBGET integrated database retrieval system