KEGG   Saccharomyces cerevisiae (budding yeast): YHR152W
Entry
YHR152W           CDS       T00005                                 

Gene name
SPO12, SDB21
Definition
(RefSeq) Spo12p
  KO
K12576  sporulation-specific protein 12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YHR152W (SPO12)
   04113 Meiosis - yeast
    YHR152W (SPO12)
SSDB
Motif
Pfam: Spo12
Other DBs
NCBI-GeneID: 856557
NCBI-ProteinID: NP_012022
SGD: S000001195
UniProt: P17123
LinkDB
Position
VIII:401434..401955
AA seq 173 aa
MSNKASDQSARTASILKTDITRENTITRSSSSNNDNYHHHNNINNYNESAKTGEDANKEN
IPNLEEEIAAFRIFRKKSTSNLKSSHTTSNLVKKTMFKRDLLKQDPKRKLQLQQRFASPT
DRLVSPCSLKLNEHKVKMFGKKKKVNPMKLNFKGNLAADSEDVEIDEDEEYFY
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccaacaaggcaagtgaccaatcagcacgcacggcttccatcctcaagactgatatt
accagagaaaacacaatcaccagaagcagcagcagcaacaacgacaactaccatcaccac
aataacatcaataattacaatgaatcggcgaagacaggagaggacgccaataaagagaat
atacctaatttagaggaggagattgcggcctttcgaatttttaggaaaaaaagcacttca
aacttgaagtcgtcacacaccactagcaatttggtaaaaaagacaatgttcaaaagggat
cttttaaaacaggatccgaagaggaaactccaactacaacaaagatttgcatcaccgact
gacaggctggtatcaccatgctcattgaaattgaatgagcacaaagttaagatgttcgga
aagaaaaagaaagtcaatcctatgaaactgaactttaaaggcaaccttgctgccgattca
gaggatgtagaaatcgatgaagatgaggagtatttctactaa

DBGET integrated database retrieval system