KEGG   Saccharomyces cerevisiae (budding yeast): YHR184W
Entry
YHR184W           CDS       T00005                                 

Gene name
SSP1, SPO3
Definition
(RefSeq) Ssp1p
  KO
K12783  sporulation-specific protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YHR184W (SSP1)
SSDB
Other DBs
NCBI-GeneID: 856590
NCBI-ProteinID: NP_012054
SGD: S000001227
UniProt: P38871
LinkDB
Position
VIII:472744..474459
AA seq 571 aa
MRSSGTYENDPSGEITSTSPKQSKQKKPTKFRERMRRWLQNGKNNNHQGEEDVPEIFNKN
FYPQTGMTAFNNNDNGEVQDVTNNFFLPSEDESGPVQSSVKTFLTGNNDEDSNFQQNQNP
KQKSELPKSPYRQKPTQEIALLKDLFVTNKYDDPYLNSSTRFGNITSTFPSSLSLRTVTL
QTIKKRIDCISAKKKEVWKTEEKFLKDILMWLQSSNFEDPDTISLIHEIEKIFEEDIHFE
QNVSDCLKEISNNFEYICMRETQLINEGNILKNDLKKYAKAREHKGEKHEDTEVLREKVI
SSQKSFDVTKRHYKHAISITTRQLFMNLAFEYYENCSDMKDISRKYLQESLSTLQTIDTL
SFSEELEKIRKRRFDKFWAKTNPDPTNNIQKFVNMRTGVAGFNDSLMNHLYGKLSFGVAP
VEEELQNSQPEHTDVPENVWNEVLSDYNSMDGNPITSNKFLSAKELEPDQLVELLAQEKE
EKEAKNISSSTAEVPSISQPEIKKENLESNDSLILRSTKRNVNVNAASLRNLSIKKTQVK
PESASEESKVLAAALNDAKQNLDENVWRTPI
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgagaagctctggcacatatgagaatgatccttctggggaaataacctcaacttcccca
aagcagtcgaagcagaaaaagcctaccaaatttagggaaagaatgcgcaggtggttacaa
aatgggaaaaataacaaccaccaaggagaggaggatgttcctgaaatatttaacaagaat
ttttatccgcaaacaggcatgacagctttcaacaataatgataatggtgaggttcaggat
gttacaaacaatttttttttgcccagtgaagatgaatctggtccagttcaaagtagtgtt
aaaacttttttaactggtaacaatgatgaagattctaacttccaacaaaaccagaatcct
aaacaaaagtccgaacttccaaagtcaccttaccggcaaaaacctacgcaagaaatagca
ttattgaaagatcttttcgttaccaacaaatatgacgatccctatttgaattcttccaca
aggtttggtaacataacttcaacttttcccagtagtttgtcattgaggactgtcacctta
caaacaataaaaaaaagaattgactgtatttctgcaaaaaaaaaagaagtgtggaagaca
gaggaaaaatttctaaaagatatcttaatgtggttacagagttcaaattttgaagaccct
gatacaatatcattaatacatgaaattgaaaaaatatttgaagaggatatccattttgaa
caaaacgtgtcggattgcttaaaagaaatctcaaataatttcgaatatatctgcatgcga
gaaacccaattgataaacgaaggaaacatactaaaaaatgacttaaaaaagtacgcaaaa
gcaagggaacataaaggcgaaaagcatgaagatactgaagtcttgagggaaaaagtaata
tcatcacaaaaatcgtttgatgttacaaagaggcactataagcatgcaatttcaataacg
acaagacagctatttatgaatttggcgtttgagtactacgaaaattgttcagatatgaag
gatatttcgagaaaatacctacaagaatctttgtccactttacaaactatcgacacattg
agtttttcggaagaattagaaaaaattagaaagagaagatttgataagttttgggcaaaa
actaatcctgatccaacaaacaatattcaaaagtttgttaatatgagaacaggagtagca
ggttttaatgattccttaatgaatcacttgtacgggaaactaagtttcggggtagcgcca
gttgaagaagaattacaaaactcacagccggagcacactgatgtgcctgaaaatgtttgg
aatgaggttctctctgattataattcaatggatggtaatccaattacttcaaataaattc
ctttctgcgaaagaacttgagcccgatcaattagttgaacttctcgctcaggaaaaagaa
gagaaagaggcaaaaaatatcagctcttcaactgcagaagttccatcgatatcgcaacct
gaaataaagaaggagaatctcgaatcaaatgattccttgattttaagaagcacgaaaaga
aatgtaaatgtcaatgccgctagtttgaggaatctttccattaaaaaaactcaagtcaaa
ccggagtctgcaagtgaagaaagcaaagttcttgctgcagctttaaatgatgcaaaacaa
aacttggatgaaaacgtctggagaactcctatctaa

DBGET integrated database retrieval system