KEGG   Saccharomyces cerevisiae (budding yeast): YIL099WHelp
Entry
YIL099W           CDS       T00005                                 

Gene name
SGA1
Definition
(RefSeq) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YIL099W (SGA1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     YIL099W (SGA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 DUF3775 LMP
Motif
Other DBs
NCBI-GeneID: 854708
NCBI-ProteinID: NP_012167
SGD: S000001361
UniProt: P08019
LinkDB All DBs
Position
IX:178004..179653
Genome map
AA seq 549 aa AA seqDB search
MARQKMFYNKLLGMLSVGFGFAWALENITIYEFDFGKGILDQSYGGVFSNNGPSQVQLRD
AVLMNGTVVYDSNGAWDSSALEEWLQGQKKVSIEKIFENIGPSAVYPSISPGVVIASPSQ
THPDYFYQWIRDSALTINSIVSHSAGPAIETLLQYLNVSFHLQRSNNTLGAGIGYTNDTV
ALGDPKWNVDNTAFTEDWGRPQNDGPALRSIAILKIIDYIKQSGTDLGAKYPFQSTADIF
DDIVRWDLRFIIDHWNSSGFDLWEEVNGMHFFTLLVQLSAVDKSLSYFNASERSSPFVEE
LRQTRRDISKFLVDPANGFINGKYNYIVGTPMIADTLRSGLDISTLLAANTVHDAPSASH
LPFDINDPAVLNTLHHLMLHMRSIYPINDSSKNATGIALGRYPEDVYDGYGFGEGNPWVL
ATCTASTTLYQLIYRHISEQHDLVVPMNNDCSNAFWSELVFSNLTTLGNDEGYLILEFNT
PAFNQTIQKIFQLADSFLVKLKAHVGTDGELSEQFNKYTGFMQGAQHLTWSYTSFWDAYQ
IRQEVLQSL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaaaagatgttttataacaaattactcggcatgctcagcgtaggattcggg
tttgcttgggcgctcgagaacattactatatacgaatttgactttggcaagggcattctc
gatcaaagctacggcggtgtattttcaaacaacggcccttcgcaagtgcagctgcgggat
gcagtcttgatgaatgggacagtggtatacgattcaaacggcgcttgggacagtagtgcg
ctggaggaatggctccagggacagaaaaaagtttccatcgaaaaaatatttgaaaatatt
gggcccagcgccgtgtatccgtctatttcgcctggggtcgtgattgcgtcaccatcgcaa
acgcatccagactacttctaccaatggataagggacagcgcgttgacgataaacagtatt
gtctctcattctgcgggcccggcaatagagacgttattgcagtacctgaacgtttcattc
cacttgcaaagaagcaacaacacattgggcgctggcattggttacactaacgatacagtg
gctttgggagaccctaagtggaacgtcgacaacacggctttcacggaagattggggtcgt
cctcaaaacgatgggcctgctcttcgaagcattgccatcttaaaaatcatcgactacatc
aagcaatctggcactgatctgggggccaagtacccattccagtccaccgcagatatcttt
gatgatattgtacgttgggacctgaggttcattattgaccactggaattcttccggattt
gatctatgggaggaagtcaatggcatgcatttctttactttactggtacaactgtctgca
gtggacaagtcgctgtcgtattttaacgcctcagaacggtcgtctccctttgttgaagaa
ttgcgtcagacacgccgggacatctccaagtttttagtggaccctgcgaatgggtttatc
aacggcaagtacaattatattgttgggacacccatgattgccgacacattgagatccgga
ctggacatatccactttattagctgcgaacaccgtccacgatgcgccatctgcttcccat
cttccgttcgatatcaatgaccctgccgtcctgaacacgttgcaccatttgatgttgcac
atgcgttcgatataccccatcaacgatagctccaaaaatgcaacgggtattgccctgggc
cggtatcctgaggacgtatatgatggatatggctttggcgagggaaatccctgggtcctg
gccacgtgtaccgcttcaacaacgctttatcagctcatttacagacacatctctgagcag
catgacttggttgtcccaatgaacaacgattgttcgaacgcattttggagcgagctggta
ttctccaacctcacgactttgggaaatgacgaaggctatttgattttggagttcaataca
cctgccttcaatcaaaccatacaaaaaatcttccaactagctgattcattcttggtcaag
ctgaaagctcacgtgggaacagacggggaactaagtgaacaatttaacaaatacacaggg
tttatgcagggtgcccaacaccttacctggtcctatacttcattctgggatgcctatcaa
ataagacaagaagttttacagagtttgtag

DBGET integrated database retrieval system