KEGG   Saccharomyces cerevisiae (budding yeast): YIR025W
Entry
YIR025W           CDS       T00005                                 

Gene name
MND2
Definition
(RefSeq) Mnd2p
  KO
K12781  anaphase-promoting complex subunit MND2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YIR025W (MND2)
SSDB
Motif
Pfam: Apc15p
Other DBs
NCBI-GeneID: 854843
NCBI-ProteinID: NP_012291
SGD: S000001464
UniProt: P40577
LinkDB
Position
IX:403659..404765
AA seq 368 aa
MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKK
SRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFK
PIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENE
EYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEE
GEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDS
KVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERR
ARQQRGQD
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcaagagcgttgagggatatatcattattcaatgatataagaaaggatcaaaattcg
gcaggagccaagcatgagagatataacatgagagatctccgaagtaagaagaaccagcat
gtaaatggcatagatgattatgaagatgattcgcttgacagatttataagaaggaagaaa
tccagagttgtgaaatacattccatcattgtcagcgtataatgtgttcaatgaatttcct
tactatcctacgtcagccagtcagttactagacggcaaattagacgaatttctaatgctg
tcagaacaatacaaaagtagattacccaaaatacgcaagctaggatggaatagattcaaa
ccaataggcattaataaaactatgtacgaattagaaatgctaaggtctcgagcacgagct
caaaacgcggaagggaacaatgaggaagacttcaggcagcacgattctagagaagaggat
ccaagaaacaatggctctataggacgcgtgatactgcctcatattctacaggaaaatgaa
gaatatgatactggtgagggtgttacaggattgcatagcatgccaaatgacagtatggcc
atacttgcgaataacagtgctaataattcgcaaaatgaggaagtatcagaggaggatgaa
atatcatacgattatgatgcagagttcgatcatgttgtagatgaggatgataatgaggag
ggagaagtgccgggggaaggtgtggaaggtatagaagttcagagagagagaattgtgccg
gatgacttattaatgagacccacttcactgtcacgctccctacaacagtttgtggaagag
gctcatcatttagatagaaacccatatgatattgacagtgataacgacggagaagattca
aaggtagaactggacatgaatccggattttgaagatgacgtgggaagagagcatgattat
aatagcgaatacagccaagagccgacttcttatggtgggattacacctgatctagcgagt
aattggaggaattggactagggagaggataactagtttagatgaattaatggagagacga
gccaggcagcaacgaggtcaagattag

DBGET integrated database retrieval system