KEGG   Saccharomyces cerevisiae (budding yeast): YJL035C
Entry
YJL035C           CDS       T00005                                 

Symbol
TAD2
Name
(RefSeq) tRNA(adenine34) deaminase
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YJL035C (TAD2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     YJL035C (TAD2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    YJL035C (TAD2)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam APOBEC_N Bd3614-deam NAD1 SNAD4 APOBEC2 APOBEC3
Other DBs
NCBI-GeneID: 853417
NCBI-ProteinID: NP_012499
SGD: S000003572
UniProt: P47058
Structure
LinkDB
Position
X:complement(380249..381001)
AA seq 250 aa
MQHIKHMRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGI
DQIKAMLGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFGCGNERFGGNGTVLS
VNHDTCTLVPKNNSAAGYESIPGILRKEAIMLLRYFYVRQNERAPKPRSKSDRVLDKNTF
PPMEWSKYLNEEAFIETFGDDYRTCFANKVDLSSNSVDWDLIDSHQDNIIQELEEQCKMF
KFNVHKKSKV
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcagcatattaaacatatgaggacagctgtccgtttggctagatacgctcttgaccac
gatgagacaccggtagcttgcatctttgtacatacgccaactggccaggtgatggcttat
ggcatgaacgatacgaacaagtcattaactggagtagcacatgctgagttcatggggatc
gatcagatcaaggcgatgttgggctcccgaggagttgttgacgtgttcaaagacattact
ctatatgttactgtagaaccgtgtataatgtgtgcatctgctctcaagcaattagacatt
ggaaaggtggtgttcggttgtggcaacgagagatttggaggcaacggtactgtcttgtca
gtaaatcatgatacgtgtacattagtgcccaagaacaatagtgcggcagggtacgagagt
ataccggggatcttgaggaaagaagcaataatgctgctgagatacttttatgtaagacaa
aatgaaagggcgccaaagccacggtccaagagtgacagagtgttggataaaaacacgttt
ccgcctatggaatggtcaaagtatcttaatgaagaagcattcattgagacttttggtgat
gattacaggacttgttttgcgaataaagttgacttgtccagtaatagcgtcgattgggat
ttgattgactcccaccaagataatataatccaagaactggaagaacaatgcaaaatgttt
aagtttaatgtacataagaaatctaaggtttga

DBGET integrated database retrieval system