KEGG   Saccharomyces cerevisiae (budding yeast): YJL045WHelp
Entry
YJL045W           CDS       T00005                                 

Definition
(RefSeq) succinate dehydrogenase SDH1b
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YJL045W
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YJL045W
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YJL045W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like BNIP2
Motif
Other DBs
NCBI-GeneID: 853405
NCBI-ProteinID: NP_012490
SGD: S000003581
UniProt: P47052
LinkDB All DBs
Position
X:356024..357928
Genome map
AA seq 634 aa AA seqDB search
MLSLKKGITKSYILQRTFTSSSVVRQIGEVKSESKPPAKYHIIDHEYDCVVVGAGGAGLR
AAFGLAEAGYKTACLSKLFPTRSHTVAAQGGINAALGNMHPDDWKSHMYDTVKGSDWLGD
QDAIHYMTREAPKSVIELEHYGMPFSRTEDGRIYQRAFGGQSKDFGKGGQAYRTCAVADR
TGHAMLHTLYGQALKNNTHFFIEYFAMDLLTHNGEVVGVIAYNQEDGTIHRFRAHKTVIA
TGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLEDLEFVQFHPSGIYGSGCLITEGARGEG
GFLLNSEGERFMERYAPTAKDLASRDVVSRAITMEIRAGRGVGKNKDHILLQLSHLPPEV
LKERLPGISETAAVFAGVDVTQEPIPVLPTVHYNMGGIPTKWTGEALTIDEETGEDKVIP
GLMACGEAACVSVHGANRLGANSLLDLVVFGRAVANTIADTLQPGLPHKPLASNIGHESI
ANLDKVRNARGSLKTSQIRLNMQRTMQKDVSVFRTQDTLDEGVRNITEVDKTFEDVHVSD
KSMIWNSDLVETLELQNLLTCATQTAVSASKRKESRGAHAREDYAKRDDVNWRKHTLSWQ
KGTSTPVKIKYRNVIAHTLDENECAPVPPAVRSY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgttatctttgaaaaaaggaataacaaaatcatacatcttgcaaagaactttcacttct
tcctctgttgttcgtcaaattggggaagtgaaatctgaatcgaaaccgccggccaaatat
catattatcgaccatgaatatgattgtgtggtggtaggcgctggcggtgcaggtttaaga
gcagctttcggtttggctgaagctggatacaagactgcttgtttatccaagttgtttcca
acaaggtcacatactgtggctgctcagggtggaattaatgctgcgctgggaaatatgcat
ccagatgattggaaatcgcacatgtacgacactgtcaagggttctgactggctcggagac
caagatgcaatccattacatgacaagagaagcacctaagtctgtcattgaactagaacat
tacggtatgcccttttcgaggactgaagatggaaggatttaccagagagcatttggggga
caatccaaagattttggtaaaggtggacaggcctataggacttgtgcggtggcagataga
acaggtcacgcaatgcttcatacattgtatggacaagcgctgaaaaataatacacacttc
tttattgaatactttgcaatggatttgttgacccataatggcgaggttgtgggtgtcatt
gcctataatcaggaggacggtacaattcacagattcagagcacataagaccgtcatcgcg
acaggcggatacggtagagcttacttctcttgcacttctgctcacacttgtacaggtgac
ggtaatgctatggtttctcgcgctggatttccactagaggatttagaatttgttcaattt
catccgtcaggaatttatgggtctggctgcctaatcactgaaggtgcccgtggtgagggt
ggatttttattgaattctgaaggagaaaggtttatggaacgctatgctcctactgccaag
gacttggcaagcagggatgttgtttccagagcaatcaccatggaaatcagggctggcaga
ggtgtcgggaaaaacaaggatcatatccttttacaattaagccatctaccacctgaggta
ctaaaggaaaggctaccgggaatatctgaaacagctgctgtctttgcgggtgtcgatgtc
acccaggagccaattcctgtcttgccaactgtccattataatatgggaggcattcccaca
aaatggactggtgaagcattgaccattgacgaggaaactggagaggataaggtcatccca
ggattgatggcgtgtggtgaagctgcttgcgtatcggttcatggagcgaacagattaggc
gctaactcactactggatttagtcgttttcggtcgcgccgttgcaaataccattgctgac
acattacagcctggcttgcctcataagccattggcttcaaacatcgggcacgagtcaatt
gctaatttggataaagtaagaaatgctcgcggctcactgaaaacctctcaaatcaggttg
aacatgcaaaggacaatgcaaaaagatgtttctgttttcaggacgcaagacactctagat
gaaggtgttagaaatattactgaagtggacaagacatttgaggatgtgcacgtttctgat
aagtcaatgatctggaattctgatctcgtagaaactctggaattgcaaaatttacttact
tgtgccacacaaacggctgtttctgcttccaaaagaaaggagtctcgtggtgctcatgcg
agagaggactatgcaaaaagagatgatgtgaattggagaaagcacacattatcatggcaa
aaggggacatcaacacctgtaaaaatcaagtacaggaatgtaatcgcacatactttagat
gagaatgaatgcgccccagtccctccagctgtcagatcctattaa

DBGET integrated database retrieval system