KEGG   Saccharomyces cerevisiae (budding yeast): YJL106W
Entry
YJL106W           CDS       T00005                                 

Gene name
IME2, SME1
Definition
(RefSeq) protein kinase IME2
  KO
K12765  meiosis induction protein kinase IME2/SME1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJL106W (IME2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YJL106W (IME2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YJL106W (IME2)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   YJL106W (IME2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pox_ser-thr_kin Haspin_kinase Kdo SIKE
Other DBs
NCBI-GeneID: 853338
NCBI-ProteinID: NP_012429
SGD: S000003642
UniProt: P32581
LinkDB
Position
X:221390..223327
AA seq 645 aa
MVEKRSRQSSSSGSEFSVPPDVDNPPLSIPLKTLSDRYQLIEKLGAGSFGCVTLAKAQFP
LSNILGKQHDIRGTLMDQPKNGHQNYITKTQGVVAIKTMMTKLHTLQDYTRVREIKFILA
IPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVFSIPSLKSILSQILAG
LKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADFGLARHVENKNP
YTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQIWKILEV
LGTPIKRSDFVNTNHITAPPPGGFWDDASNLVHKLNLKLPYVEGSSLDHLLSSSQLSDLS
EVVKKCLRWDPNERATAQELCEMPFFENTVASQVDARGNVTNTEQALIFAGINPVATNTK
PIYFNSSTKLPAETESNDIDISNNDHDSHAMCSPTLNQEKLTLVEFLNEFVEEDNDDHSI
PDVGTDSTISDSIDETELSKEIRNNLALCQLPDEEVLDHSLSNIRQLTNDIEIINKDEAD
NMEQLFFDLEIPEKDEFQRKQPFNEHADIDEDIVLPYVNNSNYTHTDRSHHRGDNVLGDA
SLGDSFNSMPDFTPRNFLIPTLKKSREKFEPHLSNSNQHFGNVTF
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggttgaaaaacgtagtagacagagttccagtagtggctcagagttcagtgttccacct
gatgtcgataacccgccactttctatccctttgaagactttatcagacagatatcagctg
atcgaaaaactaggtgcaggatcatttggttgtgtaactttagccaaagcgcaatttcct
ttatcgaacatattgggtaaacaacatgatataaggggtactttaatggatcagcctaaa
aatggtcaccaaaactatataacaaagacacaaggtgtagtggctataaagacaatgatg
acaaaactgcatacactccaggattatacgagggtcagagaaattaagttcatactggca
atcccagcgaatgaccatctgatacaaatttttgaggtctttattgactctgaaaattac
caattacatatcgtaatggaatgtatggagcaaaacctatatcaaatgatgaaacataga
aggcgccgagttttttcgattccttctttgaaatctattctatcgcagatactggctggg
ttaaaacacatccacgaacataatttcttccacagagatttaaaacctgaaaatattctt
atcacaccaagtacccagtattttgaaaaggagtacatgaaccagattggatatcaagat
aactatgtcattaaacttgcagattttggtttggcacgccatgttgaaaataaaaacccg
tatacggcctacgtttccacaagatggtatagatcgcctgaaatattattaagaagtggt
tactattccaaacctttggatatttgggcattcgggtgcgtggcggtggaagttactgta
ttcagagctctcttccccggtgctaacgaaatcgatcagatatggaaaattttagaagtt
cttggtacacctatcaaacgttctgattttgttaatacaaaccacatcacagctccacca
cctggtggattttgggatgatgccagtaatttggtccataaattaaacttgaaattgcct
tatgtagaaggttcatcgttggatcatctactttctagctcccaactatccgatttatct
gaggttgtcaaaaagtgtttaagatgggatcctaatgaaagggcaacagcccaagagctt
tgtgaaatgccattttttgaaaacaccgtggcatcccaagtagacgcaagaggcaatgtg
actaatacagaacaagcattgatttttgcaggtataaatccagtagcgaccaacacaaag
cccatatattttaactcttcaacaaaattgcccgcagaaacagagtctaatgatattgat
atcagcaacaacgatcacgattctcatgctatgtgctcaccaacattaaatcaagaaaaa
ctaactttggtagaatttttaaacgaattcgttgaagaagataatgatgatcactcaata
cctgatgttggaacagattctaccatttcagattctattgatgagactgaattatcaaaa
gaaattcgtaataatttggccctttgtcaactaccagatgaagaagtcttagatcattca
ttatcgaatattaggcagttgacaaatgatattgaaattataaataaagatgaagcagac
aacatggaacagctattttttgacctggaaattcctgaaaaggatgagtttcagagaaaa
caaccatttaatgaacatgcagatattgatgaagacatcgttctaccatatgtgaacaac
tcaaattacacacatacagataggtcacatcatagaggtgataatgttttgggtgatgcc
tctttaggcgattcgtttaattcaatgccagattttactccaagaaatttcttgatacct
acattaaaaaaatcacgggaaaagttcgagcctcatctatccaattcaaaccaacatttt
ggaaatgtaaccttctaa

DBGET integrated database retrieval system