KEGG   Saccharomyces cerevisiae (budding yeast): YJL164C
Entry
YJL164C           CDS       T00005                                 

Gene name
TPK1, PKA1, SRA3
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YJL164C (TPK1)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJL164C (TPK1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YJL164C (TPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YJL164C (TPK1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YJL164C (TPK1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YJL164C (TPK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YJL164C (TPK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  PKA family
   YJL164C (TPK1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YJL164C (TPK1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YJL164C (TPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Seadorna_VP7 DUF3297
Other DBs
NCBI-GeneID: 853275
NCBI-ProteinID: NP_012371
SGD: S000003700
UniProt: P06244
LinkDB
Structure
PDB: 
1FOT

Position
X:complement(109966..111159)
AA seq 397 aa
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTSGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtcgactgaagaacaaaatggaggtggtcaaaagtctctagatgatagacaaggtgag
gaatcacaaaaaggtgagactagtgaaagggaaacaacagccacagagagcggtaacgaa
agtaagtctgtagaaaaagagggtggagaaacccaagaaaaaccgaagcagccacatgtc
acttattacaatgaggagcagtataaacagtttattgcccaagcgagagttacaagtggg
aagtatagtttacaagactttcagatattaaggacactgggtacgggttcttttggtagg
gtccatttgattagatcaagacataatggcagatactacgccatgaaagttttgaaaaag
gaaatcgtggtaagattgaaacaggtggagcataccaacgacgagcgattgatgctttct
atcgtaacacatccgtttattattagaatgtgggggactttccaagatgctcagcaaatt
ttcatgattatggattatattgaaggtggagaattgttttctttgttaaggaaatcccaa
agatttcccaacccagttgctaaattttacgcagcggaagtttgtttagctttggagtac
ttgcatagcaaggacattatttatagggatttgaaaccggaaaatatcttgcttgataaa
aacgggcatataaagataacagatttcgggtttgccaaatacgttcctgacgtcacatat
acattatgcggtactcccgactacatagcacccgaggtcgttagtactaaaccatataat
aaatctatcgattggtggagtttcggtattctgatttacgaaatgctagcaggatacacg
ccattttacgactctaacacgatgaaaacctatgagaaaatcttgaatgccgaattgaga
tttccaccatttttcaacgaagatgtaaaggacctgttgagtagattgatcacaagagac
ttaagtcaaagactaggtaatttacaaaatggtacagaagatgtcaaaaaccacccctgg
ttcaaagaagttgtctgggaaaaattattatctagaaacatagaaacgccgtatgaaccg
cccattcaacagggacaaggtgacacctcacagttcgataagtacccggaagaagacatc
aactacggtgttcaaggtgaagacccatatgctgatcttttccgggacttctaa

KEGG   Saccharomyces cerevisiae (budding yeast): YKL166C
Entry
YKL166C           CDS       T00005                                 

Gene name
TPK3
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK3
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YKL166C (TPK3)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YKL166C (TPK3)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YKL166C (TPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YKL166C (TPK3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKL166C (TPK3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YKL166C (TPK3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YKL166C (TPK3)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  PKA family
   YKL166C (TPK3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YKL166C (TPK3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YKL166C (TPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Nucleoporin_N APH YrbL-PhoP_reg Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 853688
NCBI-ProteinID: NP_012755
SGD: S000001649
UniProt: P05986
LinkDB
Position
XI:complement(134509..135705)
AA seq 398 aa
MYVDPMNNNEIRKLSITAKTETTPDNVGQDIPVNAHSVHEECSSNTPVEINGRNSGKLKE
EASAGICLVKKPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLK
KHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKS
QRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT
YTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAEL
KFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYE
PPIQQGQGDTSQFDRYPEEEFNYGIQGEDPYMDLMKEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtatgttgatccgatgaacaacaatgaaatcaggaaattaagcattactgccaagaca
gaaacaactccagataacgttggacaagacattcctgtaaacgcacattcggtgcatgag
gaatgttcttccaacacacccgtggagataaatggaagaaacagcggaaagttgaaagaa
gaagcgtctgcaggtatttgtttggttaaaaaaccaatgctacaatatagagatacctca
ggaaagtattccctaagtgactttcagattttaagaactttgggaactggctcatttggg
agagttcacctaattcgttccaatcacaatgggaggttttacgctttgaagacattgaaa
aagcacactatagtgaagctgaagcaggttgaacacaccaatgacgaacgccgaatgctt
tcaattgtttcacatccattcatcattcgaatgtggggaacgttccaagattctcagcaa
gttttcatggtaatggactacattgaaggtggtgaattattttctttactacgtaaatct
caaagatttcccaacccagtagccaaattttatgccgcagaggtatgcttagcgttggaa
tatttgcacagtaaggatataatatatagagacttgaaaccagaaaatatccttctagat
aaaaacggccatatcaagataaccgactttggcttcgcaaaatacgttcccgatgtcaca
tacacattatgtggcacaccagattacatagcgccggaagtggtcagtacaaaaccgtat
aataaatcagtggattggtggagttttggtgtgctaatctatgaaatgcttgccggatac
actccattttacaattcgaacaccatgaaaacttacgaaaatatactgaacgccgaattg
aagttcccaccatttttccatccagacgcgcaggacttattgaagaagctaattaccaga
gacttaagtgaaaggttgggtaacttacaaaatggaagtgaagatgtcaagaaccatccg
tggtttaacgaagtgatatgggagaaattgttagcaagatacatagaaacgccgtacgaa
ccaccaatccaacagggccaaggtgacacttctcaatttgacagataccctgaagaggaa
ttcaactatggaattcaaggggaggatccatatatggatttaatgaaagaattttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YPL203W
Entry
YPL203W           CDS       T00005                                 

Gene name
TPK2, PKA2, PKA3, YKR1
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit TPK2
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPL203W (TPK2)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YPL203W (TPK2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YPL203W (TPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YPL203W (TPK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPL203W (TPK2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YPL203W (TPK2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     YPL203W (TPK2)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  PKA family
   YPL203W (TPK2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YPL203W (TPK2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    YPL203W (TPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like YrbL-PhoP_reg Seadorna_VP7
Other DBs
NCBI-GeneID: 855898
NCBI-ProteinID: NP_015121
SGD: S000006124
UniProt: P06245
LinkDB
Position
XVI:166256..167398
AA seq 380 aa
MEFVAERAQPVGQTIQQQNVNTYGQGVLQPHHDLQQRQQQQQQRQHQQLLTSQLPQKSLV
SKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERR
MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA
LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTK
PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLI
TADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPE
EQLDYGIQGDDPYAEYFQDF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaattcgttgcagaaagggctcagccagttggtcaaacaatccagcagcaaaatgtt
aatacttacgggcaaggcgtcctacaaccgcatcatgatttacagcagcgacaacaacaa
caacagcagcgtcagcatcaacaactgctgacgtctcagttgccccagaaatctctcgta
tccaaaggcaaatatacactacatgacttccagattatgagaacgcttggtactggatct
tttggtagggttcatttggtgcgctctgttcacaatggtcggtattatgctataaaagtt
ttaaagaaacaacaagttgtcaagatgaaacaggttgaacataccaatgacgaacgacgt
atgctaaagcttgtggagcatccgtttctgattagaatgtggggtacgtttcaagatgct
aggaatatctttatggtgatggattatatcgaaggtggtgaacttttctcgttactgaga
aagtcacaaagatttcctaatcctgtagcaaaattttacgctgcggaagtcatactggca
ttagagtacttgcatgctcataatatcatctacagggatttaaagccagaaaatatcttg
ctggatagaaatggccacattaaaataaccgattttgggttcgccaaagaggtacaaact
gtcacatggacgctttgtgggactcctgattacattgctcctgaagttattaccacaaag
ccatataataagtcggtggattggtggtctctaggtgttctaatctacgaaatgttagct
ggttatacacccttttacgatactactccaatgaagacgtatgaaaagattttacaaggt
aaagtagtatatccaccatattttcatcccgacgtcgtggatctactaagcaaactgatc
actgcagatttgacaagaagaatcggtaatttacaaagcggttccagggacatcaaagct
cacccatggtttagtgaagttgtatgggaaagattgttagcaaaggatattgaaactcca
tacgagcctcctatcacatcaggtatcggtgacacgtctttattcgatcaatatcccgag
gagcagctagattatggtattcaaggcgatgatccatatgctgaatactttcaagatttc
taa

DBGET integrated database retrieval system